KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1378Help
Entry
A7A1_1378         CDS       T02384                                 

Definition
Alkaline phosphatase 3 (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bsl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bsl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bsl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3435993..3437381
Genome map
AA seq 462 aa AA seqDB search
MKKFPKKLLPIAVLTSIAFSSLASGSVPEASAQEKKKGNHDEIKNVIVLIGDGMGVSYTS
AYRYLKDNKKTKVVEPTAFDQYLVGQQTTYPDDPEQNVTDSAAAATAMSAGIKTYNNAIA
VDNDGSEAKTVLEAAKEKGKATGLVATSEITHATPASFGSHDHSRKNMNSIADDYFDEMV
NGKHKIDVLLGGGKSNFDRKDRNLIKEFKKAGYSYVDDRKDMLKNKDSQVLGLFADGGLP
KKIDRTKDIPSLKDMTNTAIKKLNKDKDGFFLMVEGSQIDWAGHDNDIVGAMSEMEDFEQ
AYKAAIDFAKKDKHTLVVATADHSTGGYSIGADGIYNWFSEPIKAAKRTPDFMAEKIADG
ADVEKTLKTYIDQKKLTLTKAEIQSVEEAAKSKEVLDIDNAIENIFNKRSHTGWTTGGHT
GEDVPVYAYGPSSETFAGQIDNTEIAKNVFKALQYNIKINDK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaattcccgaagaaattactgcctatcgcggttttaacatcaattgcgttcagc
agcttagccagcggcagtgtgcctgaagccagcgcccaggaaaagaaaaaggggaaccac
gacgaaattaaaaatgttattgttctgattggtgatggtatgggtgtgtcttatacgtct
gcttatcgatacttaaaggataataaaaagacaaaagttgtggagcctacggcttttgat
cagtaccttgtcggccagcaaacaacttaccccgatgatcctgaacaaaatgtaacagat
tctgcagcggcggcaacggctatgtctgcgggaattaaaacatacaataatgccatagcc
gttgataacgacgggtcagaagccaaaacggtgcttgaagctgcgaaagaaaaaggaaaa
gcaacaggacttgtggccacttcagaaattacacacgccactccggcctcttttggttca
cacgaccacagccgaaaaaatatgaactcaattgcggatgattattttgatgagatggtc
aacggcaagcacaaaattgatgtccttctaggcggaggaaagagcaattttgaccgtaag
gaccgtaatttgattaaggaattcaaaaaggcggggtacagctacgtggatgatcgcaag
gacatgctgaaaaacaaagacagccaagttctcggcctattcgctgacggcggcctgcct
aaaaagattgaccgtacgaaggatattccatcacttaaagatatgacaaacacagccatt
aaaaaattaaacaaggataaagacggattcttcctcatggtggaaggcagccagattgac
tgggcgggccatgacaatgatatcgttggcgccatgagcgagatggaagacttcgaacaa
gcttataaggcggctattgatttcgctaaaaaagacaagcacacattggttgtcgcaacg
gctgaccactcaaccggcggatattccatcggtgcggacggcatctacaactggttcagt
gaacccattaaagccgcaaagcgcacaccagactttatggcagaaaagatcgctgacggc
gcggatgttgaaaaaacgttgaaaacatatatcgatcaaaagaaattgactttaacaaaa
gccgaaattcaatctgttgaagaagcggcaaaatcgaaggaagtactggatatcgataac
gcaatcgagaacatctttaataaacgctctcacactggatggacaacaggcggacatacc
ggtgaagatgttcccgtctatgcatacggtccgtctagtgagacatttgccggccaaatc
gacaatacagaaatcgccaaaaatgttttcaaggctttacaatacaacattaagattaac
gataagtaa

DBGET integrated database retrieval system