KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1388Help
Entry
A7A1_1388         CDS       T02384                                 

Definition
hypothetical protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bsl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3427474..3428871)
Genome map
AA seq 465 aa AA seqDB search
MAQTEQYRFPKDFWWGSSASATQTEGAADRDGKGQNIWDYWFEKEPHRFFDHVGPADTSQ
FYDNYKEDIRLMKELGHNSFRMSISWSRLIPNGTGEINDKAANFYNNVIDELIANGIEPF
VNLFHFDMPMALQKIGGWVNRETVDAYENYARTCFRLFGGRVKKWFTHNEPIVPVEGGYL
YDFHYPNKVDFKEAVQVGFHTMLSSARAIQAYREMEQDGKIGIILNLTPSYPRSSHPADV
KAGEIADAFFNRSFLDPSVKGEFPKELVDILKHEGFMPDYNAEDLDIIKKNTVDLLGVNY
YQPRRVKAKEHLPNPDAPFLPDRYFDPYVMPGRKMNPHRGWEIYEKGVYDILINLKENYG
NIECFISENGMGVEGEERFRDEQGIIQDDYRIEFIKEHLKWIHRAIQEGSNVKGYHLWTF
MDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKKVAEHSGF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
ttggcacaaacagaacaatatcgttttccaaaggatttttggtggggatcatcggcttca
gcaacacaaacggagggtgccgccgacagagacggaaaaggccagaatatatgggattat
tggtttgaaaaagaaccgcatcgtttttttgatcatgtcggccccgcagacacatcccaa
ttttacgacaactataaagaagatatcaggctgatgaaggagcttggccacaactcgttc
cggatgtcgatttcctggtcacgtttaataccaaacggaacgggcgagatcaacgataaa
gccgcaaatttctataacaatgtcattgatgagttaatcgctaacggaattgaacctttt
gtcaatttgtttcatttcgatatgccgatggcgcttcaaaaaatcggcggctgggtcaac
agagagacggttgacgcgtatgaaaactatgcaagaacttgcttccgtttgtttggcggc
cgggtgaaaaaatggttcacgcataatgaaccaatcgttcccgtagaaggcggataccta
tatgattttcattatccaaacaaggtagactttaaagaggccgtccaggttggatttcat
acgatgctgtcaagtgcccgcgccattcaggcttacagggagatggagcaggacggaaaa
atcggaatcattttaaatttgaccccatcatacccgagaagcagccatccggcggatgta
aaagccggggaaatcgcagacgcgttttttaacagatcctttttagacccatctgtcaaa
ggcgaatttccaaaagagctggttgacattttgaagcatgaaggctttatgcctgattac
aacgctgaagatcttgacatcatcaaaaagaacacggttgacctgttgggagtgaattat
taccagccgagacgtgtgaaagcgaaagaacatcttccgaatcccgacgctccttttttg
cctgacaggtattttgatccctacgtcatgccgggccgcaaaatgaatccgcatcgcggc
tgggagatctatgaaaaaggcgtttatgatattttaattaatttaaaagaaaactacggc
aacatcgagtgttttatctctgaaaacggtatgggggttgaaggtgaagagcgattcagg
gatgaacaaggcatcattcaagatgattaccggattgaatttataaaagagcacctcaaa
tggattcaccgcgccatacaggaaggctcgaacgtaaaaggctatcacttatggacgttc
atggacaactggtcttggacaaatgcctataaaaaccgatacgggtttgtatcagtcaat
cttgagaaagacggggaaagaaccgtcaaaaagagcggaaaatggttcaaaaaggttgct
gaacatagcggtttctag

DBGET integrated database retrieval system