KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1565Help
Entry
A7A1_1565         CDS       T02384                                 

Definition
lipoprotein YbbD
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A7A1_1565
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    A7A1_1565
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A7A1_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3855406..3857334
Genome map
AA seq 642 aa AA seqDB search
MRPVFPLILSAVLFLSCFFGARQTEASASKRSIDANQIVNRMSLDEKLGQMLMPDFRNWQ
KEGESSPQALTEMNDEVASLVKKYQFGGIILFAENVKTTKQTVQLTDDYQKASPKIPLML
SIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGSIIGKELSALGINTDFSPVVDIN
NNPDNPVIGVRSFSSNRELTSRLGLYTMKGLQRQDIASALKHFPGHGDTDVDSHYGLPLV
SHGQERLREVELYPFQKAIDAGADMVMTAHVQFPAFDDTTYKSKLDGSDILVPATLSQKV
MTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVKAGVDIALMPASVTSMKEEQK
FARVIQALKEAVKNGDIPEQQINKSVERIISLKIKRGMYPARNSDSTKEKIAKAKKIVGS
QQHLKAEKKIAEKAVTVLKNEQHTLPFKPKKGSRILIVAPYEEQTASIEQTIHDLIKRKK
IKPVSLSKMNFANQVFKAEHAKQVKKADYIITGSYVVKNDPVVNDGVIDDTISDSSKWAT
VFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKALIAVYGFKGYANGRYLQPNIPAGV
MAIFGQAKPKGTLPVNIPSVTKPGNTLYPFGYGLNIKTGRPL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgtctttccgcttatcctttcagccgttctctttctttcatgctttttcggg
gccagacagacagaagcctctgcatccaaacgttcaatcgatgccaatcagattgtcaat
cgtatgtcgttagatgaaaaactcggccagatgctgatgcctgattttagaaattggcaa
aaggaaggcgagtcctctccgcaagcccttacagaaatgaatgatgaagtcgccagcctc
gtcaagaaatatcaattcggaggcatcatcctttttgcagaaaatgtaaaaacaacaaaa
caaactgtccaactgacagacgattaccaaaaggcaagtccaaaaatcccgctcatgctg
agtattgatcaggaaggcggcattgtaacgcggttaggggagggcactaatttcccaggg
aatatggcactgggcgcagccagaagcagaatcaatgcgtatcagaccggcagcatcatc
gggaaagagctctctgccttaggcatcaatacagatttcagccctgtcgtggacattaac
aataatcctgataatcctgtaatcggcgtacggtcattcagctccaatcgagaactgaca
tcacgcctcggtctatatacgatgaaagggttgcagcggcaggatatcgcgtctgccctc
aaacatttcccgggacatggagacacggacgttgacagccattatggactgccgctcgtt
tcccatggccaagaacggcttcgtgaggtcgagctttatccttttcaaaaagcaattgat
gctggtgctgatatggtgatgacagcccatgttcaattccctgccttcgacgacaccaca
tacaaaagcaaactcgatggatcggacattctggttcctgctacactttcgcaaaaagtg
atgacaggtcttcttcgtcaggaaatgggctttaatggggtcatcgttaccgatgcgctc
aatatgaaggcaattgcagatcatttcggacaggaggaggctgtggtcatggccgtaaaa
gctggtgtcgatattgcattaatgccagcctcagtcacttcaatgaaagaagaacagaaa
ttcgcacgtgtcattcaagctttgaaagaagccgtgaaaaacggggatattcctgaacaa
caaatcaacaaatcagttgaaagaatcatttccctgaaaataaaacgcggcatgtatcca
gcacgaaacagcgacagtacaaaagaaaaaatagccaaagccaaaaaaatcgtaggaagc
cagcagcacctgaaagcagagaaaaaaatagctgaaaaagcagtaactgtattaaaaaat
gaacagcacactttgccgttcaagcctaaaaaaggcagccgaatcttaattgtggcacct
tacgaagaacaaactgcttcaatcgaacaaaccattcacgatctcatcaagcgaaagaaa
atcaaacccgtatccctcagcaaaatgaactttgccaaccaagtatttaaggccgagcat
gcaaaacaagtaaaaaaggctgattatatcataaccggctcctatgtcgtcaaaaatgac
cctgtcgtcaacgacggtgtcatcgacgacacaatatcagattcaagcaaatgggccacc
gtgtttccgagagctgtcatgaaagccgcactgcagcacaacaaaccatttgtcttaatg
agcctgcgcaacccatatgatgccgccaatttcgaagaagcaaaggcactgattgcagtc
tatggctttaaaggatacgcaaatggccgttatcttcaacctaatattccggccggagtg
atggcgattttcggccaggcaaaacctaaaggcacacttccagttaacatcccatcagtc
acgaaaccagggaacaccctttacccatttggctacggattaaatatcaaaacgggaaga
ccgctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system