KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1565Help
Entry
A7A1_1565         CDS       T02384                                 

Definition
lipoprotein YbbD
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bsl00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bsl00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3855406..3857334
Genome map
AA seq 642 aa AA seqDB search
MRPVFPLILSAVLFLSCFFGARQTEASASKRSIDANQIVNRMSLDEKLGQMLMPDFRNWQ
KEGESSPQALTEMNDEVASLVKKYQFGGIILFAENVKTTKQTVQLTDDYQKASPKIPLML
SIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGSIIGKELSALGINTDFSPVVDIN
NNPDNPVIGVRSFSSNRELTSRLGLYTMKGLQRQDIASALKHFPGHGDTDVDSHYGLPLV
SHGQERLREVELYPFQKAIDAGADMVMTAHVQFPAFDDTTYKSKLDGSDILVPATLSQKV
MTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVKAGVDIALMPASVTSMKEEQK
FARVIQALKEAVKNGDIPEQQINKSVERIISLKIKRGMYPARNSDSTKEKIAKAKKIVGS
QQHLKAEKKIAEKAVTVLKNEQHTLPFKPKKGSRILIVAPYEEQTASIEQTIHDLIKRKK
IKPVSLSKMNFANQVFKAEHAKQVKKADYIITGSYVVKNDPVVNDGVIDDTISDSSKWAT
VFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKALIAVYGFKGYANGRYLQPNIPAGV
MAIFGQAKPKGTLPVNIPSVTKPGNTLYPFGYGLNIKTGRPL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgtctttccgcttatcctttcagccgttctctttctttcatgctttttcggg
gccagacagacagaagcctctgcatccaaacgttcaatcgatgccaatcagattgtcaat
cgtatgtcgttagatgaaaaactcggccagatgctgatgcctgattttagaaattggcaa
aaggaaggcgagtcctctccgcaagcccttacagaaatgaatgatgaagtcgccagcctc
gtcaagaaatatcaattcggaggcatcatcctttttgcagaaaatgtaaaaacaacaaaa
caaactgtccaactgacagacgattaccaaaaggcaagtccaaaaatcccgctcatgctg
agtattgatcaggaaggcggcattgtaacgcggttaggggagggcactaatttcccaggg
aatatggcactgggcgcagccagaagcagaatcaatgcgtatcagaccggcagcatcatc
gggaaagagctctctgccttaggcatcaatacagatttcagccctgtcgtggacattaac
aataatcctgataatcctgtaatcggcgtacggtcattcagctccaatcgagaactgaca
tcacgcctcggtctatatacgatgaaagggttgcagcggcaggatatcgcgtctgccctc
aaacatttcccgggacatggagacacggacgttgacagccattatggactgccgctcgtt
tcccatggccaagaacggcttcgtgaggtcgagctttatccttttcaaaaagcaattgat
gctggtgctgatatggtgatgacagcccatgttcaattccctgccttcgacgacaccaca
tacaaaagcaaactcgatggatcggacattctggttcctgctacactttcgcaaaaagtg
atgacaggtcttcttcgtcaggaaatgggctttaatggggtcatcgttaccgatgcgctc
aatatgaaggcaattgcagatcatttcggacaggaggaggctgtggtcatggccgtaaaa
gctggtgtcgatattgcattaatgccagcctcagtcacttcaatgaaagaagaacagaaa
ttcgcacgtgtcattcaagctttgaaagaagccgtgaaaaacggggatattcctgaacaa
caaatcaacaaatcagttgaaagaatcatttccctgaaaataaaacgcggcatgtatcca
gcacgaaacagcgacagtacaaaagaaaaaatagccaaagccaaaaaaatcgtaggaagc
cagcagcacctgaaagcagagaaaaaaatagctgaaaaagcagtaactgtattaaaaaat
gaacagcacactttgccgttcaagcctaaaaaaggcagccgaatcttaattgtggcacct
tacgaagaacaaactgcttcaatcgaacaaaccattcacgatctcatcaagcgaaagaaa
atcaaacccgtatccctcagcaaaatgaactttgccaaccaagtatttaaggccgagcat
gcaaaacaagtaaaaaaggctgattatatcataaccggctcctatgtcgtcaaaaatgac
cctgtcgtcaacgacggtgtcatcgacgacacaatatcagattcaagcaaatgggccacc
gtgtttccgagagctgtcatgaaagccgcactgcagcacaacaaaccatttgtcttaatg
agcctgcgcaacccatatgatgccgccaatttcgaagaagcaaaggcactgattgcagtc
tatggctttaaaggatacgcaaatggccgttatcttcaacctaatattccggccggagtg
atggcgattttcggccaggcaaaacctaaaggcacacttccagttaacatcccatcagtc
acgaaaccagggaacaccctttacccatttggctacggattaaatatcaaaacgggaaga
ccgctttaa

DBGET integrated database retrieval system