KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1646Help
Entry
A7A1_1646         CDS       T02384                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bsl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bsl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bsl00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1124866..1125963)
Genome map
AA seq 365 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDPKRLQESQLMLENLRDRYNPS
VAINSYDDRKLALQNAGYVINAIQVGGYKPSTVIDFEIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEMCPDAWFLNYTNPMATLTGAMLRYTNIKTIGLCHSVQVCTKDLF
KALGMEHDGIEERIAGINHMAWLLEVKKDGTDLYPEIKRRAKEKQKTKHHDMVRFELMDK
FGYYVTESSEHNAEYHPYFIKRNYPELISELQIPLDEYPRRCVKQIENWEKMRDDIVNNK
HLTHERSKEYGSRIIEAMETNESFTFGGNVLNTGLITNLPSKAVVEVTCVADRKKNYTVL
RRRTA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattacatttatcggtgcagggagcacgattttcgccaaaaatgttttggga
gactgcctgttaacagaggcactgaatggatttgagttcgctctttacgacattgatccc
aaacgcctgcaagaatcccagctcatgctcgaaaatctaagagaccgttataacccaagt
gtggccatcaacagctatgatgacagaaaactcgccttgcaaaacgcaggctatgtcatc
aatgcgattcaggttggaggatacaaaccgagcacagtcatcgatttcgagattcctaaa
cggtatgggctgcgccagacgatcgccgatacagtcggcatcggcgggatattcagatct
ctcagaacaatcccggtcttatttgatatcgcaaaagatatggaggaaatgtgccctgac
gcatggttcttaaactatacaaatccaatggccacccttacaggcgccatgctccgctat
accaatatcaaaacaatcgggctctgccacagtgttcaagtgtgcacgaaggatttattt
aaagctctcggaatggagcatgacggaattgaggaacgcattgcgggcattaatcatatg
gcttggcttttggaagtcaaaaaagacggcacagatttatatccagaaatcaaaaggaga
gcgaaagaaaaacaaaaaacaaagcatcatgatatggtgcggtttgaattaatggataag
ttcggctattatgtcacggaatcgtccgaacataacgcagagtatcacccatactttatt
aaacggaattaccctgaactgatcagcgagctgcaaatcccgctcgacgaatatccgaga
aggtgcgtcaagcaaattgaaaattgggagaaaatgcgggatgatatcgtcaataataaa
caccttacgcacgaacgctcaaaggaatatggttcaagaattatagaagcaatggaaaca
aacgaatcattcaccttcggaggaaacgtcttgaatacagggctgatcaccaaccttcct
tcaaaagcggttgtggaagtgacatgcgtcgccgacagaaaaaaaaattacaccgtgctt
cgccggagaactgcctga

DBGET integrated database retrieval system