KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1677Help
Entry
A7A1_1677         CDS       T02384                                 

Definition
Putative peptidase YtjP
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsl01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bsl00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1158029..1159420
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRKKEDLIRDTQEFLRINSVMDETTAGPGKPFGEGVNASLTSLLELGEKEGFT
TKNLDGFAGHIEWGEGDDIIGVLCHVDVVPPGDGWTSDPFSAEIRNGRIYARGAIDDKGP
TMAAFYALKIVKDMNLPLSKRVRMIIGTDEESDWRCVEHYFKHEEMPTMGFAPDADFPII
NAEKGIIDASLLIPHRPNQAEPKAVLVSFQSGLRLNMVPDAAEAVIEGPKNEEILSSFKD
MLRTTDQKGEAAIENRQLILRMYGLSCHAMEPNNGINAGILLCEFLQQTELDDAGKRFVQ
VVTDKFSGDTRGKKLDIDCGDEISGELTLNVGTLRYKEGQGGELGINIRYPVTAESKVIR
DAFESASEFELGEFKDSKPHHVSADHPLVKTLQKVYEGQLGKKADLISIGGGTYARSLKA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagttgaagtgatcagaaaaaaagaggatttaattcgtgatacgcaggaa
tttttgagaatcaacagtgtcatggacgaaacaaccgctggacccggtaaaccgtttgga
gaaggggtaaatgccagcctgacttcattgctggagcttggagaaaaagaaggctttaca
acaaaaaatcttgacggcttcgcaggtcatattgaatggggggagggcgatgacattatc
ggcgtactttgccatgttgacgtcgtgccgccgggagatgggtggacgagtgatccattt
tcagctgaaatccgcaacggacggatttatgcaaggggcgccattgatgacaaaggcccg
acaatggcggcattctacgcgctgaaaatcgtgaaagacatgaatttgcccctgtccaag
cgagtcagaatgattatcggaacagatgaagaaagcgattggagatgcgtagagcattat
ttcaagcatgaagaaatgccaacaatgggctttgcgcctgacgccgattttccaatcatt
aatgcggaaaaagggatcatcgatgcttctttacttattccgcaccgcccaaatcaagca
gaaccaaaggcagtgcttgtctcgtttcaatcaggccttcgcttaaacatggtgcccgac
gctgcggaagctgtcattgaagggccgaaaaatgaagagattctgtcttcatttaaagac
atgctccgcacgacggatcaaaaaggggaagctgcaatagagaacagacagctcattttg
cgtatgtacggtctttcctgccatgcaatggaaccgaacaatgggatcaatgccggcatt
ttattgtgcgaatttctccagcagactgagcttgacgatgcaggaaagcggtttgtgcaa
gttgtgacagataagttctcaggtgatacaagaggaaaaaaactggacatcgactgtggg
gatgaaatcagcggtgagctgacattaaatgtcggaacactgcgctataaagaagggcag
ggaggcgagctcgggatcaatatccgctatcctgtgacagcggaaagcaaagtgatccgc
gatgcattcgaaagtgcatcagaatttgagctgggagaattcaaagacagcaagccgcat
cacgtgtccgcagatcatccgttagtcaaaaccctgcaaaaggtttatgaaggccagctg
ggtaaaaaagctgacttaatctcaatcggcggggggacatatgcgaggtccttaaaagcc
ggtgtcgcgttcggcccgctgttccccggacgccctgacagcgcacaccaaaaggatgaa
tatatcgaaattgatgacctgctgagatcgacagcgttatatgctcaggccatttacgag
cttgcaaaataa

DBGET integrated database retrieval system