KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1677Help
Entry
A7A1_1677         CDS       T02384                                 

Definition
Putative peptidase YtjP
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A7A1_1677
  Amino acid metabolism
   00300 Lysine biosynthesis
    A7A1_1677
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     A7A1_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1158029..1159420
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRKKEDLIRDTQEFLRINSVMDETTAGPGKPFGEGVNASLTSLLELGEKEGFT
TKNLDGFAGHIEWGEGDDIIGVLCHVDVVPPGDGWTSDPFSAEIRNGRIYARGAIDDKGP
TMAAFYALKIVKDMNLPLSKRVRMIIGTDEESDWRCVEHYFKHEEMPTMGFAPDADFPII
NAEKGIIDASLLIPHRPNQAEPKAVLVSFQSGLRLNMVPDAAEAVIEGPKNEEILSSFKD
MLRTTDQKGEAAIENRQLILRMYGLSCHAMEPNNGINAGILLCEFLQQTELDDAGKRFVQ
VVTDKFSGDTRGKKLDIDCGDEISGELTLNVGTLRYKEGQGGELGINIRYPVTAESKVIR
DAFESASEFELGEFKDSKPHHVSADHPLVKTLQKVYEGQLGKKADLISIGGGTYARSLKA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagttgaagtgatcagaaaaaaagaggatttaattcgtgatacgcaggaa
tttttgagaatcaacagtgtcatggacgaaacaaccgctggacccggtaaaccgtttgga
gaaggggtaaatgccagcctgacttcattgctggagcttggagaaaaagaaggctttaca
acaaaaaatcttgacggcttcgcaggtcatattgaatggggggagggcgatgacattatc
ggcgtactttgccatgttgacgtcgtgccgccgggagatgggtggacgagtgatccattt
tcagctgaaatccgcaacggacggatttatgcaaggggcgccattgatgacaaaggcccg
acaatggcggcattctacgcgctgaaaatcgtgaaagacatgaatttgcccctgtccaag
cgagtcagaatgattatcggaacagatgaagaaagcgattggagatgcgtagagcattat
ttcaagcatgaagaaatgccaacaatgggctttgcgcctgacgccgattttccaatcatt
aatgcggaaaaagggatcatcgatgcttctttacttattccgcaccgcccaaatcaagca
gaaccaaaggcagtgcttgtctcgtttcaatcaggccttcgcttaaacatggtgcccgac
gctgcggaagctgtcattgaagggccgaaaaatgaagagattctgtcttcatttaaagac
atgctccgcacgacggatcaaaaaggggaagctgcaatagagaacagacagctcattttg
cgtatgtacggtctttcctgccatgcaatggaaccgaacaatgggatcaatgccggcatt
ttattgtgcgaatttctccagcagactgagcttgacgatgcaggaaagcggtttgtgcaa
gttgtgacagataagttctcaggtgatacaagaggaaaaaaactggacatcgactgtggg
gatgaaatcagcggtgagctgacattaaatgtcggaacactgcgctataaagaagggcag
ggaggcgagctcgggatcaatatccgctatcctgtgacagcggaaagcaaagtgatccgc
gatgcattcgaaagtgcatcagaatttgagctgggagaattcaaagacagcaagccgcat
cacgtgtccgcagatcatccgttagtcaaaaccctgcaaaaggtttatgaaggccagctg
ggtaaaaaagctgacttaatctcaatcggcggggggacatatgcgaggtccttaaaagcc
ggtgtcgcgttcggcccgctgttccccggacgccctgacagcgcacaccaaaaggatgaa
tatatcgaaattgatgacctgctgagatcgacagcgttatatgctcaggccatttacgag
cttgcaaaataa

DBGET integrated database retrieval system