KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1821Help
Entry
A7A1_1821         CDS       T02384                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00900  Terpenoid backbone biosynthesis
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
bsl01130  Biosynthesis of antibiotics
Module
bsl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7A1_1821
Enzymes [BR:bsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     A7A1_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AGA22439
Position
complement(3989510..3990388)
Genome map
AA seq 292 aa AA seqDB search
MKAMRILEKAPAKINLSLDVTRKRPDGYHEVEMIMTTIDLADRIELTELAEDEVRVSSHN
RFVPDDQRNLAYQAAKLIKDRYNVKKGVSIMITKVIPVAAGLAGGSSDAAATLRGLNRLW
NLNLSAETLAELGAEIGSDVSFCVYGGTALATGRGEKIKHISTPPHCWVILAKPTIGVST
AEVYRALKLDGIEHPDVQGMIEAIEEKSFQKMCSRLGNVLESVTLDMHPEVAMIKNQMKR
FGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRMIGEQNALD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctatgcgtattttagaaaaagcgccagctaagatcaatctgtcacttgacgtc
acccgaaaacgcccggatggctatcatgaagtcgaaatgatcatgacgacaattgattta
gctgatcgaattgaattgacggagcttgcagaggatgaagtgagggtttcctcccacaac
cgatttgtgcctgatgaccaaagaaacttagcttatcaggctgccaagctgatcaaggac
agatacaacgtgaaaaagggagtttccatcatgattacgaaggtaattccggtggctgcc
ggtcttgccggcggaagcagtgatgcggcggcgacactcagagggctgaacagactgtgg
aatttaaatctgtccgcggaaacgcttgctgagcttggagcggaaattggctctgacgtt
tcattttgtgtctatggcggaactgcattagcaacagggcgcggcgagaaaattaaacat
atcagcacgcctccgcactgctgggtcattttagcgaagccgacaatcggtgtttcaact
gctgaagtgtacagagcgctgaaactggatggtatagagcatcccgatgtacaaggcatg
atcgaggcgatagaagagaagagttttcagaagatgtgcagccgtttaggcaatgtgctt
gaatctgttacgctcgatatgcatcctgaagttgcaatgatcaaaaaccagatgaaacgc
tttggtgcagatgccgtgttaatgagcgggagcggcccgacagtgtttggactggttcag
tatgagtcgaaggtgcagagaatttataacgggttaagaggcttctgcgatcaagtttat
gcggtgagaatgatcggcgaacagaacgctcttgattaa

DBGET integrated database retrieval system