KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1870Help
Entry
A7A1_1870         CDS       T02384                                 

Definition
(GenBank) Uroporphyrinogen-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00860  Porphyrin and chlorophyll metabolism
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
bsl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A7A1_1870
Enzymes [BR:bsl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     A7A1_1870
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     A7A1_1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: AGA22488
Position
3686994..3688445
Genome map
AA seq 483 aa AA seqDB search
MIMKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILYDRLANPKLLEFASPDCQFIYCGK
LPNRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEADALHEHGIRYEMVPGI
TSGIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEGLARSVQTLVFYMGVKNL
SYICQQLISYGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQKVQEHQITNPAIIVIGDIV
NFQTHSWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADVIEWPKWRTENMPVNEDILR
KIGTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAASEQAKTELEKRGFLVTAIQP
NSEKTLVVGSRHAVEFMQKHESCSFYITHENVIDDRFTHMIQRTISESPLHMVICPNKLS
VQQLINGGEQIGISPELSASRPPIVCIGDDSAAEAYGFTAVQEQDELLAFIQNQQTQKKL
LHS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaagaacggaatcgtatatttcgtgggagccggacccggcgacccaggcctg
ctcaccatcaaaggaaaacaggcgctcaaggaagcagatgtgattttatatgaccggctc
gccaacccgaagctgctcgaatttgcatcaccggactgccagtttatttattgcggaaaa
ctgccaaaccgccattttatgaaacaaaaagaaattaacgccctgctggttgaaaaagca
ttaaatgggttaaccgtcgttcgcttgaagggcggagatccgagcgtattcggcagagtc
ggcgaggaagcagatgctcttcatgagcacggcattcgctatgaaatggtgccgggaatc
acctctggaattgcagcgccgctatatgcgggcatccccgtcacgcatcgggattttgca
tcgtcttttgccatgattacagcgcatgataaatcattaaaaggcacgccgaaccttgac
tgggaagggctggcccgaagcgttcaaacccttgttttttacatgggtgtcaagaacttg
tcttatatttgccagcagcttatttcatacgggaaatcgccttctgtccctgtcattgtc
atccaatggggaacgtggggccgccagcggagtgtgaaaggaacacttgagaacattcag
caaaaagtgcaggaacaccagattacaaaccctgcgattatcgtcatcggagacatcgtc
aactttcaaacacacagctggtttgaaagcaaaccgctcatcggacggcatttgatggtt
gtgactcatggcgaagatgaagacccgcttgcagacaagctgcgcgattccggcgccgat
gtcatcgagtggccgaaatggcggaccgaaaacatgcctgtcaatgaagacattcttcga
aaaattggcacctttgaagacgtttttttcacatcgcgccgggcagtttgtgaatttttc
agagcactggcttctcagaaaatcgacatccgccagctgacagccaaactgagtgcagca
tctgagcaagcaaagacagagcttgagaaacggggctttcttgtcaccgccattcagcct
aattcagaaaaaactctggttgttgggagccgccatgcagtggaattcatgcaaaagcat
gaatcctgttcgttttatatcactcatgaaaacgtcatagatgaccggttcacccacatg
attcagcgtaccatcagtgaatccccgctgcacatggtcatttgcccgaacaagctgtcc
gttcagcaattgatcaatggtggcgaacaaattggcatttcgccggaattgtcagcaagc
cggccccctatcgtctgtataggcgatgactcagctgccgaagcttatggattcacagct
gtacaagaacaggatgaattgctagctttcattcagaatcaacagacgcagaaaaagctc
cttcacagctga

DBGET integrated database retrieval system