KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1936Help
Entry
A7A1_1936         CDS       T02384                                 

Definition
Phosphodiesterase/alkaline phosphatase D PhoD
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A7A1_1936
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A7A1_1936
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A7A1_1936
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A7A1_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3756579..3757736)
Genome map
AA seq 385 aa AA seqDB search
MILSSISVITYMNTAQMNMYQKTGNVRTHNSAEIITLQDYRNRHAQYRSDANLKAAHAAF
PWVVTWDDHEVENNYANKIPEKGQSVEAFVLRRAAAYQAYYEHMPLRISSLPNGPDMQLY
RHFTYGNLASFNVLDTRQYRDDQANNDGNKPPSDESRNPNRTLLGKEQEQWLFNNLGSST
AHWNVLAQQIFFAKWNFGTSASPIYSMDSWDGYPAQRERVINFIKSKNLNNVVVLTGDVH
ASWASNLHVDFEKTSSKIFGAEFVGTSITSGGNGADKRADTDQILKENPHIKFFNDYRGY
VRCTVTPHQWKADYRVMPFVTEPGAAISTRASFVYQKDQTGLRKVSSTTIQGGVKQSDEV
EEDRFFAHNKAHEKQMIKKRAKITN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgatcttgtcttccatctcggtgattacatatatgaatacggcccaaatgaatatgtat
caaaaaacaggcaatgtccgcacgcacaacagcgcggaaatcattacgctgcaagactat
cggaaccgtcacgctcaataccgttctgacgccaatcttaaagctgcacatgcggcattc
ccttgggttgtaacttgggatgaccatgaagttgaaaacaactatgccaataaaatacct
gaaaaaggacagtcggttgaagcattcgtgctccgccgcgcggcagcataccaggcatac
tatgaacatatgccgctccgcatttcctctttgccgaatggcccagatatgcagctgtac
cggcactttacgtacggaaacctggcgtccttcaatgtgcttgatacccgccagtacagg
gacgaccaagccaataacgacggcaataagccgccttctgatgaatcgcgcaatccgaat
cggactctgcttggaaaagaacaggagcagtggctcttcaacaatttgggcagctcgaca
gcccactggaatgtgctggcgcagcagattttctttgccaagtggaatttcgggacaagc
gcaagcccgatctacagcatggattcgtgggacggctacccggctcagcgcgaacgggtt
atcaatttcattaaaagcaaaaatctgaataatgttgtcgtactgacaggtgatgtacac
gcaagctgggcatcgaatttgcatgtcgatttcgagaagacaagttcaaaaatattcgga
gccgaatttgttggaacctcgatcacttccggagggaacggagcggataagcgagcggat
acggaccaaattttaaaagaaaatccgcacatcaagttctttaacgactatcgcggatat
gtccgctgtacagtgacgcctcaccagtggaaagccgattatcgggtgatgccatttgtg
accgagccgggcgcagccatttccacgcgggcttcattcgtttaccagaaagaccaaact
gggttgagaaaggtatcatccacaacaatccaaggcggggtgaagcaatccgatgaggtc
gaagaggatcgtttctttgcgcacaacaaagcccacgaaaaacaaatgattaagaagcgg
gcaaaaatcacgaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system