KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2136Help
Entry
A7A1_2136         CDS       T02384                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A7A1_2136
Enzymes [BR:bsl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     A7A1_2136
Exosome [BR:bsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7A1_2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055374..1057257
Genome map
AA seq 627 aa AA seqDB search
MAAASPTAHDVYLFHEGSLFESYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSW
SGEEHVMHRVNDSGIWTLFIPGLGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASL
TYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYI
KEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQQNIGVILDW
VPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEF
YHIDGFRVDAVANILYWPNQDERHTNPYAVEFLKKLNQTMREAYPHVMMIAEDSTEWPQV
TGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHD
EVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDW
FLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKH
GEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHK
PCYITMTIPPYGISILRAVKKRGEIKR
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgccagcccgacagcacatgatgtttatctttttcacgaaggcagtctgttt
gaaagctatcagctgtttggctcgcattaccgcgagctgaatggcaaaagcggatatgaa
ttctgtgtgtgggcgcctcatgcgtcggaagtacgagtggctggagattttaacagctgg
tctggagaagagcatgtgatgcacagagtgaatgatagtggtatttggacgttatttatt
ccaggtttaggagaaaaggaacgatataaatatgaaatcgtgacgaataacggtgagatc
aggctgaaggcagatccatacgctatttattcagaagtcagaccaaacacagcgtcactt
acttacgatttggaagggtacagctggcaagatcaaaaatggcaaaagaaacagaaggct
aagacgctgtatgaaaaacctgttttcatttatgaactgcatcttgggtcttggaagaag
cattctgatggcaggcattattcctataaagaattaagtcagacgcttatcccttatatc
aaggagcatgggtttacccatattgaactgcttccggtgtatgagcatccatatgatcgt
tcatggggataccaaggaacggggtattacagcccgacaagcaggtttggcacgccgcat
gatctgatgaagtttgttgatgaatgtcatcaacaaaatatcggagtcattttggattgg
gtccccggacatttttgtaaagatgcacatggactctatatgtttgatggagaaccgctt
tatgaatacaaagaagaacgtgatcgggagaactggttatggggcacggcaaactttgac
ctgggaaaaccggaagttcatagttttttaatttcgaatgcgttgtactgggcggaattc
tatcatatagatggatttagggttgatgcagtggctaatatcttgtattggccaaatcag
gatgaacgccacacgaatccatatgctgttgagtttttaaaaaaactcaatcaaaccatg
agagaggcatatccccatgtgatgatgattgcggaagattctacagaatggcctcaagtg
acaggtgccgttgaggaaggggggcttggttttcattataaatggaatatgggatggatg
aatgacgtactgaaatacatggagacgccgcccgaagaaaggcggcattgtcatcagctt
atctctttttcattactatatgcgtttagtgaacattttgtattgccgttttctcatgat
gaagtcgtatacggaaaaaaatcacttcttaataaaatgcctggcgactactggcagaaa
tttgcccagtatcggcttttgcttggctatatgacagtgcatcccggaaagaaattgatc
tttatgggatcagagtttgcccaatttgatgaatggaaagatacagaacagcttgattgg
tttttggactccttccccatgcatcagaaagccagcgtttttacgcaagatcttctccgc
ttttaccaaaaaagcaaaatcctttatgagcatgaccatcgtgcacaatcgtttgaatgg
attgatgtccataatgacgaacaatcaatcttttcttttattcgttatggcaaaaagcac
ggtgaggcgcttgtcatcatttgtaattttacacccgtggtctatcatcaatatgatgtt
ggagttcctttttttactcaatacattgaagtgcttaacagtgacagtgaaacatatgga
ggctcagggcaaatcaacaaaaagccattatcggccaaaaagggagcacttcatcataaa
ccgtgttatatcacgatgaccatccccccttacggtatctcgattttacgggcggttaaa
aaaagaggagagataaaaagatga

DBGET integrated database retrieval system