KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2183Help
Entry
A7A1_2183         CDS       T02384                                 

Definition
Lysophospholipase protein YtpA
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A7A1_2183
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     A7A1_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1103404..1104183
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVAVIVIIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGTTTRARGHIRS
FQEYIDEVDAWIDKARTFDLPVFLLGHSMGGLVAIEWVKQQRNPRITGIILSSPCLGLQI
KVNKALDLASKGLNVIAPSLKVDSGLSIDMATRNEDVIEADQNDSLYVRKVSVRWYRELL
KTIESAMVPTEAFLKVPLLVMQAGDDKLVDKTMVIKWFNGVASHNKAYREWEGLYHEIFN
EPEREDVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctggaaagcagacagacctgttgcagtgattgtaatcattcacggggcaagt
gaatatcacggacgatataaatggctgattgaaatgtggcggtcttcgggttatcacgtt
gtcatgggcgatttgcctggacagggaacaacgacaagagcgagagggcatattcgctcg
tttcaagaatacattgatgaagtagatgcttggatagataaagcgcgaacctttgatctg
ccggtttttcttctaggtcacagcatgggcggtctggtcgcgattgaatgggttaaacag
caaagaaatccccggattacgggaattattttatcatcaccgtgtctcggactgcaaatt
aaagtcaataaagcgcttgatcttgcatcaaaaggcctgaatgtcatcgctccgtcactt
aaggttgattcgggattatcaattgatatggcgacgcgcaatgaggacgtcatcgaggct
gaccaaaatgattcgttatacgtcaggaaagtttctgtcagatggtacagagagctttta
aagacaattgaatcggcaatggtgccgacagaggcatttttgaaagttccgcttcttgtg
atgcaagccggtgatgacaagcttgttgacaaaacgatggtcatcaagtggtttaatggt
gttgcttctcataataaagcatacagagagtgggaagggctttaccatgagatcttcaat
gaacccgagagagaagatgtctttaaagcagcaagagcgtttactgatcaatatatttga

DBGET integrated database retrieval system