KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2331Help
Entry
A7A1_2331         CDS       T02384                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A7A1_2331
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A7A1_2331
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A7A1_2331
Enzymes [BR:bsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A7A1_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
912144..913211
Genome map
AA seq 355 aa AA seqDB search
MELMWKGLIQQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEQLGIELHVKTEGVNPTGS
FKDRGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPNGKIAFGKLAQ
AVMYGAEIIAIDGNFDDALKIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGQAP
DVLAIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGAAAIVRNEVIENPETIATA
IRIGNPASWDKAVKAAEESNGKIDEVTDDEILHAYQLIAREEGVFAEPGSCASIAGVLKQ
VKSGEIPKGSKVVAVLTGNGLKDPNTAVDISEIKPVTLPTDEDSILEYVKGAARV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttggagctaatgtggaaaggacttatccagcaatataaagaatttttacctgtaacagat
caaacaccggcgctaactttacatgaaggaaacacacctcttattcacctgccgaagctg
tctgagcagctcggaattgagcttcatgtcaaaacggaaggcgtcaatcctacgggatca
tttaaagatcgcggaatggttatggctgttgcaaaggcaaaagaagaaggcaatgacacg
attatgtgcgcgtcaacaggtaacacttccgctgctgcggcagcatatgcagcccgtgct
aacatgaaatgcattgtcatcatcccgaacggaaaaattgcgtttggaaaactcgctcaa
gctgtgatgtacggagctgagattatcgcaattgacggaaactttgacgatgcgcttaaa
attgtccgttccatctgtgagaaatcaccgattgcccttgtcaactcagtcaacccttac
cgcattgaaggccaaaaaactgctgccttcgaagtgtgtgaacagctggggcaagcgccg
gatgttttagcgatcccggtcggaaacgcgggaaacatcactgcgtactggaagggcttc
aaggaatatcatgagaaaaacggcacaggccttccgaaaatgcgcggctttgaagctgag
ggtgcggcggcaattgtgcgcaatgaagtgattgaaaatccggaaacaatagcgacagcc
attcgtatcggaaacccggcaagctgggacaaagctgtaaaggcggccgaggaatccaat
gggaaaattgacgaagtcactgatgatgaaatccttcacgcctaccagctgattgcccgt
gaagaaggcgtgtttgcagaaccaggttcttgcgcgtctatcgcaggagtgctgaaacag
gtgaaatccggagaaattccgaaaggcagcaaggtcgtagctgtgttaacaggaaacgga
ctgaaagatccgaacacagcggtcgacatttcagaaatcaagcccgtcacattgccgact
gatgaagacagcatccttgaatatgtaaaaggagcggcccgtgtatga

DBGET integrated database retrieval system