KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2385Help
Entry
A7A1_2385         CDS       T02384                                 

Definition
(GenBank) Hypothetical protein YycR
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00625  Chloroalkane and chloroalkene degradation
bsl00680  Methane metabolism
bsl01100  Metabolic pathways
bsl01120  Microbial metabolism in diverse environments
bsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    A7A1_2385
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A7A1_2385
Enzymes [BR:bsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     A7A1_2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP ADH_N_assoc FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGA23003
Position
79235..80446
Genome map
AA seq 403 aa AA seqDB search
MTGNKAVVYKGKGTVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKTKKTHV
CLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLTMLSDI
FPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFG
CETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMDVTQVG
GSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLMKAILS
GRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgacaggaaacaaagcggttgtgtacaaaggcaaagggactgtagcggtggaggatatc
ggttatccggagttaatcttgagggacgggcccggcgttccaaaggcgaatgtgaatcga
aaatgtgagcatggggttattctcaaagtcattacaaccaacatttgcggaagcgaccag
catatggtcagaggccgcacaacggcgcctgaaggcttggtgctcggacatgaaatcacc
ggagaagtcattgaaacggggcgtgatgtcgaatttatcaaaaaaggcgatatcgtatcc
gttcctttcaatattgcctgcggacgctgtgtgatgtgcaaaacgaagaaaacgcatgtg
tgcctgaatgtcaatccggaccggccgggatcggcttacggctacgtcgatatgggcggc
tgggtcggcggccagtctgaatacgtcatggtgccatacgctgattttcagcttttggta
ttccctgataaagaacaggcgttagaaaagattctcgatttgaccatgctgtccgacatt
ttcccgaccggcttccatggagcttacacagcgggcgtgcaaacaggttcaaccgtttac
atcgcgggagcgggtcctgtcggcttggcagctgcacactccgctcagctccttggtgcc
tctaccgtgattgtcggcgatctgaacgaagacagactggcacaggcgagaagcttcggc
tgtgaaacggtcaacgtacaaaaacacgaccgcctcggcgagcaaattgaacaaatacta
ggtgaaccaaccgttgatgccgcagtggactgtgttggctttgaagcatccggacacggc
aatcaaggagaagcgcctgccgccgtgctgaactcgatcatggatgtcacccaggtcgga
ggcagccttggcattccaggcttatacgtgaccgaagatcccggtgcaaaggatgcggac
gccaaaacagggtcgctaaaaatccgcttcggactcggctgggccaaagcccataccttc
gtcaccggacaaacgcccgccatgacatacaaccgcaatttgatgaaagcgatcctgagc
ggcagagcgcagatcgcaaaagccgtcaatgccaccgtcatttctctggacgacgcgcca
aaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtcatcgacccgcatgga
acactgaagtaa

DBGET integrated database retrieval system