KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2385Help
Entry
A7A1_2385         CDS       T02384                                 

Definition
hypothetical protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bsl01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bsl00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bsl00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79235..80446
Genome map
AA seq 403 aa AA seqDB search
MTGNKAVVYKGKGTVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKTKKTHV
CLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLTMLSDI
FPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFG
CETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMDVTQVG
GSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLMKAILS
GRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgacaggaaacaaagcggttgtgtacaaaggcaaagggactgtagcggtggaggatatc
ggttatccggagttaatcttgagggacgggcccggcgttccaaaggcgaatgtgaatcga
aaatgtgagcatggggttattctcaaagtcattacaaccaacatttgcggaagcgaccag
catatggtcagaggccgcacaacggcgcctgaaggcttggtgctcggacatgaaatcacc
ggagaagtcattgaaacggggcgtgatgtcgaatttatcaaaaaaggcgatatcgtatcc
gttcctttcaatattgcctgcggacgctgtgtgatgtgcaaaacgaagaaaacgcatgtg
tgcctgaatgtcaatccggaccggccgggatcggcttacggctacgtcgatatgggcggc
tgggtcggcggccagtctgaatacgtcatggtgccatacgctgattttcagcttttggta
ttccctgataaagaacaggcgttagaaaagattctcgatttgaccatgctgtccgacatt
ttcccgaccggcttccatggagcttacacagcgggcgtgcaaacaggttcaaccgtttac
atcgcgggagcgggtcctgtcggcttggcagctgcacactccgctcagctccttggtgcc
tctaccgtgattgtcggcgatctgaacgaagacagactggcacaggcgagaagcttcggc
tgtgaaacggtcaacgtacaaaaacacgaccgcctcggcgagcaaattgaacaaatacta
ggtgaaccaaccgttgatgccgcagtggactgtgttggctttgaagcatccggacacggc
aatcaaggagaagcgcctgccgccgtgctgaactcgatcatggatgtcacccaggtcgga
ggcagccttggcattccaggcttatacgtgaccgaagatcccggtgcaaaggatgcggac
gccaaaacagggtcgctaaaaatccgcttcggactcggctgggccaaagcccataccttc
gtcaccggacaaacgcccgccatgacatacaaccgcaatttgatgaaagcgatcctgagc
ggcagagcgcagatcgcaaaagccgtcaatgccaccgtcatttctctggacgacgcgcca
aaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtcatcgacccgcatgga
acactgaagtaa

DBGET integrated database retrieval system