KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2385Help
Entry
A7A1_2385         CDS       T02384                                 

Definition
hypothetical protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A7A1_2385
  Energy metabolism
   00680 Methane metabolism
    A7A1_2385
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A7A1_2385
Enzymes [BR:bsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     A7A1_2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79235..80446
Genome map
AA seq 403 aa AA seqDB search
MTGNKAVVYKGKGTVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKTKKTHV
CLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLTMLSDI
FPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFG
CETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMDVTQVG
GSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLMKAILS
GRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgacaggaaacaaagcggttgtgtacaaaggcaaagggactgtagcggtggaggatatc
ggttatccggagttaatcttgagggacgggcccggcgttccaaaggcgaatgtgaatcga
aaatgtgagcatggggttattctcaaagtcattacaaccaacatttgcggaagcgaccag
catatggtcagaggccgcacaacggcgcctgaaggcttggtgctcggacatgaaatcacc
ggagaagtcattgaaacggggcgtgatgtcgaatttatcaaaaaaggcgatatcgtatcc
gttcctttcaatattgcctgcggacgctgtgtgatgtgcaaaacgaagaaaacgcatgtg
tgcctgaatgtcaatccggaccggccgggatcggcttacggctacgtcgatatgggcggc
tgggtcggcggccagtctgaatacgtcatggtgccatacgctgattttcagcttttggta
ttccctgataaagaacaggcgttagaaaagattctcgatttgaccatgctgtccgacatt
ttcccgaccggcttccatggagcttacacagcgggcgtgcaaacaggttcaaccgtttac
atcgcgggagcgggtcctgtcggcttggcagctgcacactccgctcagctccttggtgcc
tctaccgtgattgtcggcgatctgaacgaagacagactggcacaggcgagaagcttcggc
tgtgaaacggtcaacgtacaaaaacacgaccgcctcggcgagcaaattgaacaaatacta
ggtgaaccaaccgttgatgccgcagtggactgtgttggctttgaagcatccggacacggc
aatcaaggagaagcgcctgccgccgtgctgaactcgatcatggatgtcacccaggtcgga
ggcagccttggcattccaggcttatacgtgaccgaagatcccggtgcaaaggatgcggac
gccaaaacagggtcgctaaaaatccgcttcggactcggctgggccaaagcccataccttc
gtcaccggacaaacgcccgccatgacatacaaccgcaatttgatgaaagcgatcctgagc
ggcagagcgcagatcgcaaaagccgtcaatgccaccgtcatttctctggacgacgcgcca
aaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtcatcgacccgcatgga
acactgaagtaa

DBGET integrated database retrieval system