KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2429Help
Entry
A7A1_2429         CDS       T02384                                 

Definition
Glutamate 5-kinase 2 (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsl01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bsl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2052718..2053833
Genome map
AA seq 371 aa AA seqDB search
MTPDTSMKRVVVKIGSSSLTSLHGEISIRKLEALVDQVVKLKDAGNEVILVSSGAVAAGY
RKLGFIQRPEKLPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDEYRYNNV
RNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDG
NPRTNPEAKRIQRVSEITPDIEACAGDTGSIVGTGGMRSKLDAFKIVMASGIKGFLGQAD
VGDILYHAVHEQAEGTYFEAEGTLPLNQKEQWIAFNSGPEGEMILSDDCSRKITNGQSSL
YLDGVQKIKGKFKSGSVVRLMDSKGTEIGLGIVNYSSVQLQEPEKNKELTNRALIDQEAF
VCHVDFSLPVN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcctgatacaagcatgaaaagagtcgttgtgaagattggaagcagttcattaaca
agccttcatggagaaatcagcattcgtaaattagaagcgctggtcgaccaggtcgtcaaa
ctcaaagacgccggaaatgaagtgattttggtttcctcaggcgcagtggcggcgggatat
cggaagctcggatttatccaaaggcccgagaagcttccagaaaaacaagcatcagcttca
atcggccagggattgctgatggaggcttattcaaagctgtttttggcacacggctatgtc
gcatcccaaattttaattacgagaagcgatttttctgatgaatatcgatacaacaatgtc
aggaatacaatgaatgtactgctcgagcgcggcatcatcccgatcataaacgaaaatgac
acagttaccgtcaatcggctcaagtttggcgacaatgatacgctcgcagcaaaagtcgca
ggattgattgatgcagatatgcttgtgattttatcagatatcgacggattatatgacggc
aatccgcgcacaaatccagaagcgaaaaggatacagcgggtgagtgaaataacacctgac
atcgaagcatgcgcaggtgacactggaagcatcgttggcaccggcggcatgcgctctaag
cttgatgcgtttaaaatcgtaatggcgtctggcattaaaggtttcctaggtcaggcagat
gtcggcgatattttatatcacgccgttcatgaacaggcggaaggcacctattttgaagca
gaaggaacgcttccgttgaatcaaaaggagcaatggatcgcttttaattccggtccggaa
ggtgaaatgattttatcagatgattgttcacgaaaaataacaaacggccaatcgagttta
tacctagacggtgtacagaagattaaagggaaatttaaaagcggttcagttgttcggcta
atggattcaaaagggacggaaatcggccttggaatcgtcaattactcttctgtacagctt
caagaaccggaaaagaacaaggaactgacaaacagagctctaattgatcaagaagcattt
gtttgccatgtggatttttctttacctgtaaattaa

DBGET integrated database retrieval system