KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2581Help
Entry
A7A1_2581         CDS       T02384                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Brite
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     A7A1_2581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
771077..771823
Genome map
AA seq 248 aa AA seqDB search
MSMKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYEGHGVPPE
ELVHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPM
HIKSEEVMYQGVLSYARNYKKFEGKSPEQIEEEMKEFEKTPMNTLKALQDLIADVRNNVD
MIYSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVY
EFLEKLDW
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaaagttgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtg
cttttgctgcacggctttacaggcaatacagcggatgtaaggatgctgggacgatatttg
aatgaacgcggctatacgtgccacgcgcctcaatatgaaggacatggcgtcccgcctgaa
gaacttgtacatacggggcccgaagactggtggaaaaacgtaatggatggctatgaatac
ttaaaatctgaaggctatgagagcattgctgcctgcggactgtcgcttggcggggttttt
tcgctgaaattgggttacactgtacccataaagggaattgtcccaatgtgcgcaccgatg
catattaagagtgaagaggtcatgtatcaaggcgttctttcatacgctcgcaattacaaa
aagtttgaggggaaaagcccggagcaaattgaagaggaaatgaaggaattcgaaaaaacg
ccgatgaataccctcaaggcgctgcaagacttaattgctgatgtgcggaataatgtcgat
atgatttattcaccgacatttgtggtgcaggcccgtcatgaccacatgattaataccgaa
agcgccaatattatttacaacgaagtggaaactgatgataaacagctgaaatggtacgag
gaatcagggcatgtcattacactcgacaaagaacgtgacctcgtccatcaggatgtgtat
gaatttttagagaagctcgattggtaa

DBGET integrated database retrieval system