KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2732Help
Entry
A7A1_2732         CDS       T02384                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2 (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bsl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bsl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399468..400757
Genome map
AA seq 429 aa AA seqDB search
MEKLNIAGGDSLNGTVHISGAKNSAVALIPATILANSEVTIEGLPEISDIETLRDLLKEI
GGNVHFENGEMVVDPTSMISMPLPNGKVKKLRASYYLMGAMLGRFKQAVIGLPGGCHLGP
RPIDQHIKGFEALGAEVTNEQGAIYLRAERLRGARIYLDVVSVGATINIMLAAVLAEGKT
IIENAAKEPEIIDVATLLTSMGAKIKGAGTNVIRIDGVKELHGCKHTIIPDRIEAGTFMI
AGAAMGKEVIIDNVIPTHLESLTAKLREMGYHIETSDDQLLIVGGQKNLKPVDVKTLVYP
GFPTDLQQPMTALLTRAKGTSVVTDTIYSARFKHIDELRRMGANMKVEGRSAIITGPVEL
QGAKVKASDLRAGACLVVAGLMADGVTEITGLEHIDRGYSSLEKKLEGLGATIWRERMTD
EEIEQLQNS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttgaatattgccggcggtgactcgttaaacggtacagtacatatcagcggc
gctaaaaacagcgctgttgcgttaatacctgcaaccattttggcaaattccgaggtgaca
attgaagggcttccagagatttcagatattgaaacgctgcgtgacctgttaaaggaaatc
ggcggcaacgtgcattttgagaatggggaaatggttgttgaccctacgtcgatgatcagc
atgccgcttcctaacgggaaagtaaaaaagcttcgcgcgtcatattatttaatgggggcg
atgctcggccgcttcaagcaggcggtcattggattgcctggcggctgtcacttagggccc
cgtccgattgatcagcatatcaaaggctttgaagcactcggagctgaagtaaccaatgaa
caaggcgccatttatttgcgagctgaaaggctgagaggcgcaaggatttatttagatgtc
gtaagcgttggggcaacgattaacattatgcttgccgctgttttggcagaagggaaaacg
atcatcgaaaacgctgccaaggagcctgagatcattgacgtcgcgacattgcttaccagc
atgggcgccaaaatcaaaggtgcgggcaccaatgtgattcgaatcgacggcgtgaaggaa
ctgcacggctgcaagcatacgatcattccggacagaattgaagccgggacatttatgatt
gcaggggctgcaatgggcaaggaagtcattatcgataacgtcattcccactcatcttgag
tcgttaacggcaaagctgagagaaatgggctatcatatcgaaacaagcgacgaccagctc
ctcattgtcggcgggcagaagaacttaaagccggttgacgtcaaaaccctcgtatacccg
gggtttccgactgatttacagcagccgatgacggcgctcctgacaagggcgaaagggacg
agtgtcgtcacagacaccatctactcggcaagattcaagcacattgatgagctgagacga
atgggtgccaatatgaaagtagaaggcagatctgccatcatcacaggtcctgtcgagctt
caaggcgcaaaagtgaaggcgagtgatctgcgtgccggagcctgcttggtggtagccgga
ctgatggctgatggcgtcacggaaattacgggactggagcatattgaccgaggatacagc
agccttgagaagaagcttgaggggcttggagcgacaatttggcgtgaaagaatgactgac
gaagaaatagaacagcttcaaaattcataa

DBGET integrated database retrieval system