KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2756Help
Entry
A7A1_2756         CDS       T02384                                 

Definition
Endo-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Brite
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     A7A1_2756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2010450..2011091
Genome map
AA seq 213 aa AA seqDB search
MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSN
TGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTG
TYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQTKRPTGSNATITFSNHVNA
WKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttaaaaagaatttcttagttggattatcggcagctttaatgagtattagc
ttgttttcggcaaccgcctctgcagctagcacagactactggcaaaattggactgatggg
ggcggtatagtaaacgctgttaatgggtctggcgggaattacagtgttaattggtctaat
accggaaattttgttgttggtaaaggttggactacaggttcgccatttaggacgataaac
tataatgccggagtttgggcaccgaatggcaatggatatttaactttatatggttggacg
agatcacctctcatagaatattatgtagtggattcatggggtacttatagacctactgga
acgtataaaggtactgtaaaaagtgatgggggtacatatgacatatatacaactacacgt
tataacgcaccttccattgatggcgatcgcactacttttacgcagtactggagtgttcgt
cagacgaagagaccaactggaagcaacgctacaatcactttcagcaatcatgtgaacgca
tggaagagccatggaatgaatctgggcagtaattgggcttaccaagtcatggcgacagaa
ggatatcaaagtagtggaagttctaacgtaacagtgtggtag

DBGET integrated database retrieval system