KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2768Help
Entry
A7A1_2768         CDS       T02384                                 

Definition
(RefSeq) Alpha-galactosidase GalA (EC:3.2.1.22)
  KO
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A7A1_2768
  Lipid metabolism
   00561 Glycerolipid metabolism
    A7A1_2768
   00600 Sphingolipid metabolism
    A7A1_2768
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     A7A1_2768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1994831..1997071)
Genome map
AA seq 746 aa AA seqDB search
MPIKVNEETKEFHLFNRNISYIFRVLEKSKQLEHLYYGKKIKHRESFKHLIEREIRPSCN
MFEGDHTSSLEHIKQEYPSFGTTDYRYPAHMITNDAGSHVTNFQFESYEIIQGKPLLNQL
PATYVENESEAETIEITLVDHTLKSKLILSYSIYADRSVICRNSRFINTGEEAFYLNNAM
SMNVDFPDDNYEMVHLAGAWAREAHMEVQKISKGIQSVYSTRGASRHVHNPFLALKRPDT
TEHTGDVYGFSLVYSGNFLAQVEVDAYSVTRVMMGINPFCFKWKLNSKESFQTPECVMVF
SDQGLNGMSQTFHELYRTRLVRGNWRDKDRPILINNWEATYFNFNEEKILTIAKAAKDLG
IELFVLDDGWFGERHDDTSSLGDWFTNKEKLPTGIKGLSEKIDVLGLKFGLWFEPEMVCK
GTKLLNEHPNWIIATPGRSPSHGRNQFILDFTREEVVDHIFSLMDEIITGTKISYIKWDM
NRYITEAYSMSLAADQQGEVYHRYILGVYSLYERLIQKHPQILFESCAGGGARFDPGMLY
YAPQAWASDDTDAVERLKIQYGTSMVYPLNSIGSHVSAVPNHQVGRTTPIESRANVAYFG
TFGYELDVTKLNDEEKRKVKEQVSFFKEKRNLIRNGQFYRLQNPFESNEVSWMIVSEDQR
EAIVGYYKILAKPNDKYYRIKLKGLNPEKLYHIKERGSNHYGDELMNIGIILAEDYTDRA
YEYWQRELPGDFSSEIFVLKEVETAL
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaggtcaatgaggaaacgaaagaatttcatcttttcaaccgaaatattagt
tatatttttagggtgttagaaaaaagcaagcaactagagcacctgtattatggaaaaaaa
ataaaacaccgggagtcatttaagcatcttattgagcgcgaaataagaccttcttgcaat
atgtttgaaggcgatcacacttcatcattagaacacataaaacaagaatacccaagtttt
ggaactacagactatcgatatcccgcccatatgataacaaatgatgcaggcagccatgtt
acaaattttcagtttgaaagctatgaaattattcaaggaaagcccctactcaatcaattg
cctgcgacttatgtagaaaatgagagtgaagcggagaccatcgaaatcacattagtggat
catactttaaagagcaaattaattttaagttattctatttatgcggatagaagtgttatt
tgccgaaattctagatttatcaataccggtgaggaagcattttatcttaataatgctatg
agcatgaatgttgatttcccagacgacaactatgaaatggttcatctagcaggagcttgg
gcccgtgaagctcacatggaagtgcaaaaaatatcaaaaggaatccaatctgtctatagc
acgagaggtgccagcagacatgtccacaatccttttcttgctttgaagcggccggatacc
actgaacacaccggtgatgtatatggattcagcctggtatacagcggtaactttttagcc
caggttgaagtagacgcatatagtgtaacccgggtaatgatgggaattaaccctttctgt
tttaagtggaaattaaattcaaaagaatccttccaaacccctgaatgtgttatggtgttt
tctgaccaaggattaaacggaatgagtcaaacatttcatgagctttaccgtacaaggttg
gttaggggaaattggcgtgataaagaccgccctatcttaattaacaactgggaagccacg
tattttaatttcaatgaagaaaaaatcttaacaattgccaaggcggccaaggacttagga
attgagctattcgttttggatgatggctggtttggagaaagacatgatgatacaagttca
cttggggactggttcacaaacaaagaaaaattgccaactggcattaaaggcttatctgaa
aaaatagatgtattagggttaaaattcggcttgtggtttgagccagagatggtatgcaaa
ggtacaaagctattaaatgaacatccgaattggattatcgccactcctggccgctcgcct
tcacatggccgcaaccagtttattttggattttacaagagaagaagtggtcgatcatatc
ttctcgctcatggatgagattatcacgggtacaaaaataagctacatcaaatgggatatg
aaccggtatattacagaagcttattcaatgagcttggctgcagatcaacaaggggaggtt
tatcatcggtatattctaggagtctatagtctttacgagcgtttaatccaaaaacatcca
caaattttgtttgaatcttgtgcaggaggaggagctcgttttgatccggggatgctatat
tatgctccccaagcttgggccagtgatgacacagatgcagttgaacgattaaaaattcaa
tatgggacttctatggtttatccactaaattctataggaagccacgtttcggctgttccg
aaccatcaggtcggcaggaccacaccgattgaatctcgggcaaatgttgcctatttcggc
acatttggctacgaacttgatgtaacaaaactaaatgatgaagaaaaaagaaaagtgaaa
gaacaggtttccttctttaaagaaaaacgcaatctaattcgtaacggacagttttaccgg
ctgcaaaacccttttgaatccaacgaagtgtcttggatgattgtatcagaagatcaaaga
gaagcaatcgtgggatattataagatcctcgcaaaaccaaacgataaatactaccgtatt
aaattaaaaggcctaaaccctgagaaactttatcatattaaagagcggggcagcaatcat
tacggtgatgaattaatgaatataggaattattttagctgaggactacacagaccgcgct
tatgaatattggcaaagggagttgccaggtgacttctcttccgagatatttgtactgaag
gaagtagaaactgcgttgtaa

DBGET integrated database retrieval system