KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2955Help
Entry
A7A1_2955         CDS       T02384                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
bsl01130  Biosynthesis of antibiotics
bsl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A7A1_2955
Enzymes [BR:bsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     A7A1_2955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth DUF5070
Motif
Other DBs
NCBI-ProteinID: AGA23573
Position
1826123..1826875
Genome map
AA seq 250 aa AA seqDB search
MLEKIIKQKKEEVKTLVLPVEQPFEKRSFKEALASPNRFIGLIAEVKKASPSKGLIKEDF
VPVQIAIDYEAAKADAISVLTDTPFFQGENSYLSDVKRAVSIPVLRKDFIIDSLQVEESR
RIGADAILLIGEVLDPLHLHELYLEAGEKGMDVLVEVHDASTLEQILKVFTPDILGVNNR
NLKTFKTSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNEHGARAVLIGESLMRQTSQ
RKAIHALFGE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaaaatcatcaaacaaaagaaagaagaagtgaaaacactggttttgccggta
gagcagcctttcgagaaacgttcatttaaggaggcgctggcaagcccgaatcggtttatc
gggttgattgccgaagtgaagaaagcatcgccgtcaaaagggcttattaaagaggatttt
gtgcctgtgcagattgcaatagactatgaggctgcgaaggcagatgcgatttccgtttta
acagacaccccgttttttcaaggggaaaacagttatttatcagacgtaaagcgtgctgtt
tcgattcctgtacttagaaaagattttattattgattctcttcaagtagaggaatcaaga
agaatcggagcggatgccatattgttaatcggcgaggtgcttgatcccttacaccttcat
gaattatatcttgaagcaggtgaaaaggggatggacgtgctagtggaggttcatgatgca
tcaacgctagaacaaatattgaaagtgttcacacccgacattctcggtgtaaataatcga
aacctaaaaacgtttaaaacatctgtaaagcagacagaacaaatcgcatctctcgttccg
aaagaatccttgcttgtcagcgaaagcggaatcggttctttagaacatttaacatttgtc
aatgaacatggggcgcgagctgtacttatcggtgaatcattgatgagacaaacttctcag
cgtaaagcaatccatgctttgtttggggagtga

DBGET integrated database retrieval system