KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2955Help
Entry
A7A1_2955         CDS       T02384                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A7A1_2955
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A7A1_2955
Enzymes [BR:bsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     A7A1_2955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1826123..1826875
Genome map
AA seq 250 aa AA seqDB search
MLEKIIKQKKEEVKTLVLPVEQPFEKRSFKEALASPNRFIGLIAEVKKASPSKGLIKEDF
VPVQIAIDYEAAKADAISVLTDTPFFQGENSYLSDVKRAVSIPVLRKDFIIDSLQVEESR
RIGADAILLIGEVLDPLHLHELYLEAGEKGMDVLVEVHDASTLEQILKVFTPDILGVNNR
NLKTFKTSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNEHGARAVLIGESLMRQTSQ
RKAIHALFGE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaaaatcatcaaacaaaagaaagaagaagtgaaaacactggttttgccggta
gagcagcctttcgagaaacgttcatttaaggaggcgctggcaagcccgaatcggtttatc
gggttgattgccgaagtgaagaaagcatcgccgtcaaaagggcttattaaagaggatttt
gtgcctgtgcagattgcaatagactatgaggctgcgaaggcagatgcgatttccgtttta
acagacaccccgttttttcaaggggaaaacagttatttatcagacgtaaagcgtgctgtt
tcgattcctgtacttagaaaagattttattattgattctcttcaagtagaggaatcaaga
agaatcggagcggatgccatattgttaatcggcgaggtgcttgatcccttacaccttcat
gaattatatcttgaagcaggtgaaaaggggatggacgtgctagtggaggttcatgatgca
tcaacgctagaacaaatattgaaagtgttcacacccgacattctcggtgtaaataatcga
aacctaaaaacgtttaaaacatctgtaaagcagacagaacaaatcgcatctctcgttccg
aaagaatccttgcttgtcagcgaaagcggaatcggttctttagaacatttaacatttgtc
aatgaacatggggcgcgagctgtacttatcggtgaatcattgatgagacaaacttctcag
cgtaaagcaatccatgctttgtttggggagtga

DBGET integrated database retrieval system