KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3165Help
Entry
A7A1_3165         CDS       T02384                                 

Definition
(GenBank) Hypothetical protein YsdC
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
1275532..1276617
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKDLTDAKGIPGNEREVRQVMKSYIEPFADEVTTDRLGSLIAKKTGAENG
PKIMIAGHLDEVGFMVTQITDKGFIRFQTVGGWWAQVMLAQRVTIVTKKGEITGVIGSKP
PHILSPEARKKSVEIKDMFIDIGASSREEALEWGVLPGDMVVPHFEFTVMNNEKFLLAKA
WDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGI
AGDTPGISEKEAQSKMGKGPQIIVYDASMVSHKGLRDAVVATAEEAGIPYQFDAIAGGGT
DSGAIHLTANGVPALSITIATRYIHTHAAILHRDDYENAVNLITEVIKKLDRKTVDEITY
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgaaacattgaccatgctgaaagatttaacagatgcaaaaggcata
ccgggcaatgaaagagaagtaaggcaagtgatgaaatcatacatagaaccatttgctgat
gaggtgacaacagatcgcctgggcagtttaattgccaaaaaaactggtgcagaaaacggt
ccgaaaattatgatcgccggacatttggatgaagtcggctttatggtgacacaaatcaca
gataaaggctttatccgttttcaaaccgttggcggatggtgggctcaggttatgcttgcc
cagcgcgtcaccattgtcacaaaaaaaggagaaatcacaggggttatcggatctaagccg
cctcatattttgtctcctgaagcaagaaaaaaatcagtggaaataaaagacatgtttatt
gatattggagcttcaagccgggaagaagccttggagtggggtgtactcccgggagatatg
gtcgttccgcattttgagtttacggtcatgaacaatgaaaaattcctactcgcaaaggcc
tgggacaaccgcatcggctgtgcgattgcaattgatgtgttaagaaacttacaaaacaca
gaccatccaaatatagtgtatggcgtcggaaccgtgcaggaggaagtcggcctgagggga
gcgaaaacggctgcgcacaccattcagcctgatattgcgtttggtgttgatgtaggaata
gcaggagacacgcctggcatttccgagaaggaagcgcagagcaaaatgggcaaaggcccg
cagattatcgtttacgatgcatccatggtctctcacaaaggtttgcgcgatgcagttgta
gccactgcggaggaagccggcattccgtaccaatttgatgccattgccggcggcggaact
gattcgggtgccatccatttgacggcaaatggcgttcctgcgctgtccattaccattgca
acccgctacattcatacgcatgcggccatactgcatcgtgatgattatgaaaacgcggta
aatttaattacagaagtcattaagaagttagaccgaaaaacggttgacgaaattacgtac
caataa

DBGET integrated database retrieval system