KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3239Help
Entry
A7A1_3239         CDS       T02384                                 

Definition
Glutaminase 1 (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bsl00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bsl00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bsl00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3777174..3778157
Genome map
AA seq 327 aa AA seqDB search
MKELIKEHQKDINPALQLHDWVEYYRPFAANGQSANYIPALGKVNDSQLGICVLEPDGTM
IHAGDWNVSFTLQSISKVISFIAACMSRGIPYVLDRVDVEPTGDAFNSIIRLEINKPGKP
FNPMINAGALTIASILPGESAYEKLEFLYSVMETLIGKRPRIHEEVFRSEWETAHRNRAL
AYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGLILAHDGYHPIRREQVIPKDVA
KLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPPSARREQPFQSGCGIGIYGP
AIDEYGNSLTGGMLLKHMAQEWELSIF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattgataaaagagcaccagaaagacataaacccggcgttacagcttcatgat
tgggttgaatactatcgcccttttgccgccaatggacaaagcgcaaactatatccccgca
ttaggaaaagtcaatgattcacagctcggcatctgtgtattggagcctgatggaacgatg
atacacgccggcgactggaacgtctcttttaccctgcaaagcatttcaaaagtgattagc
tttattgccgcctgcatgagccgcggcattccctatgtgcttgaccgcgtagatgtcgag
ccgacaggtgacgcctttaattcaatcattcggctcgaaatcaacaagccgggaaagccc
ttcaatcccatgatcaacgcgggtgccctcaccatcgcttcgatccttcccggagaatcg
gcatacgaaaagctcgagtttctttactcggtgatggaaactttgataggaaaacggccg
agaattcatgaggaagtattccgttctgaatgggaaaccgcccaccgcaacagagcgctg
gcctactatttaaaagaaacaaactttttagaagctgaagtagaagaaacacttgaggtg
tacttgaagcaatgcgctatggagagcaccacagaagatattgcgttgatcggcctgatc
cttgctcatgacgggtatcatccgattcgacgcgagcaggtgattccaaaagatgtggca
aaattggccaaggcattaatgctgacgtgcggcatgtacaacgcttcaggcaaatatgcg
gcgtttgtcggcgtgccggccaaaagcggcgtctccggcggcatcatggcgctggtgcct
ccaagcgccagaagagaacagccttttcaatccggatgcggcatcggcatttacgggcct
gccattgatgaatacggtaacagcctcactggcggtatgctgctgaagcatatggcgcag
gagtgggagctcagcattttttaa

DBGET integrated database retrieval system