KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3429Help
Entry
A7A1_3429         CDS       T02384                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00900  Terpenoid backbone biosynthesis
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
bsl01130  Biosynthesis of antibiotics
Module
bsl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7A1_3429
Enzymes [BR:bsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     A7A1_3429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AGA24047
Position
complement(2345880..2347040)
Genome map
AA seq 386 aa AA seqDB search
MATLKNICLLGATGSIGEQTLDVLRAHQDQFQLVSMSFGRNIDKAVPMIEVFQPKFVSVG
DLDTYHKLKQMSFSFECQIGLGEEGLIEAAVMEEVDIVVNALLGSVGLIPTLKAIEQKKT
IALANKETLVTAGHIVKEHAKKYDVPLLPVDSEHSAIFQALQGEQAKNIERLIITASGGS
FRDKTREELESVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVV
LHKESIIHSMVEFHDKSVIAQLGTPDMRVPIQYALTYPDRLPLPDAKRLELWEIGSLHFE
KADFDRFRCLQFAFESGKIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEKALTRHQ
LLKKPSLADIQEVDKDTRGYVNSILT
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtggcaactttgaaaaatatttgtcttttaggagcaacaggatcaatcggcgaacagact
cttgatgtactgcgtgcacatcaagaccaatttcagctggtatctatgtcgtttggcaga
aatattgataaggccgttccaatgattgaggtctttcagccgaagtttgtctctgtcggt
gatctggatacatatcataaattaaaacaaatgtctttttcttttgaatgccaaatcggg
ctgggagaagaaggactgatagaagcagcagtgatggaggaggttgacattgttgtcaac
gctttgcttggaagcgtcggtcttatcccgacattaaaggcaattgaacagaaaaaaaca
attgcgcttgcaaataaggaaactcttgtcactgcagggcatatagtaaaagaacatgct
aagaaatatgatgttccgctgctgcctgttgacagtgagcattcagccatttttcaagct
cttcaaggcgaacaggctaaaaacattgaacgcctcatcattacggcatccggcggaagt
tttcgggacaagacgcgggaggagctcgaatcagtaacagttgaagatgcattaaaacat
ccaaactggtcaatgggtgcaaaaattacaattgattcggctacaatgatgaataaggga
ttagaggtgatcgaggcacactggcttttcgatataccttatgaacaaattgatgtggtt
ttacataaggagagcatcatccattcaatggttgagttccatgataaaagtgtgatcgca
cagctcggaactccggatatgagagtccccattcaatatgcgctcacttatcctgaccga
ttgccattaccagatgcgaaaaggcttgaattatgggaaatcggcagccttcattttgag
aaagctgattttgacaggttccgatgcttacaatttgcttttgaatcaggtaaaatagga
ggaacaatgccgacagtgctaaatgcggcaaacgaagtagctgtcgctgcctttttagct
ggcaagataccgtttttggctattgaagactgtatcgaaaaggcactaacccgccatcaa
ttactgaaaaaaccgagcctggcggacattcaagaagtggacaaagatacccggggatac
gtcaattcaatactcacataa

DBGET integrated database retrieval system