KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3476Help
Entry
A7A1_3476         CDS       T02384                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bsl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bsl00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bsl00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:bsl00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2388318..2389475)
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVESAKSLSSSVYVVKAQIHAGGRGKAGGV
KIAKSLDEVKAYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYIGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LSESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatatggggtatctgttcct
gaaggtaaagtggcttttacagcagaagaagcagttgagagtgcaaagagcttatccagc
tcggtttatgtcgtaaaggctcaaattcatgctggcggtcgaggcaaagctggtggggta
aaaatagcaaaatcattagacgaagtaaaagcgtatgccgaagaactattagggaagacc
ctagttacacatcagacgggtccggacggccaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaagaatattacatcggtctagtgcttgaccgcgccacttcaaga
atcgttttaatggcttctgaagaaggcggaacggaaattgaagaggttgcggagaaaaca
ccagaaaaaatcaaaaaagctgtcattgatccggctgttggccttcaaggctatcaagcc
agagaaattgcattcgctattaatattccaaaagagctcgtgggaaaagctgctaaattt
atgcttggactatataaagcgtttgttgagaaagactgctcaatcgccgaaatcaatccg
cttgttgtgactggcgacggaaatgtgatggcgcttgatgcaaaattgaattttgacagc
aatgcgttgtaccgacaaaaggacattatggaatacagagatttggatgaagaagatccg
aaagaaattgaagcgtccaaatatgatctaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggacttgcaatgtctacgatggatattatcaagcattatgga
ggagaaccggccaacttccttgatgtgggcggcggtgcaaccgcggaaaaagtcacggaa
gcatttaaaatcattctttctgatcaaaacgttaaagggatttttgtcaacattttcggc
ggcattatgaaatgtgatgtcatcgcagaaggggttgttgaagcgactagacaagttggt
ttgacattgccgcttgtcgtccgtcttgaaggcacaaacgtggatctagggaagaaaatc
cttagtgaatcaggattaaacattacatctgcggaatcaatggctgacggcgcgcagaaa
atcgtatccttagtttaa

DBGET integrated database retrieval system