KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3476Help
Entry
A7A1_3476         CDS       T02384                                 

Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00020  Citrate cycle (TCA cycle)
bsl00640  Propanoate metabolism
bsl00660  C5-Branched dibasic acid metabolism
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
bsl01120  Microbial metabolism in diverse environments
bsl01130  Biosynthesis of antibiotics
bsl01200  Carbon metabolism
Module
bsl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A7A1_3476
   00640 Propanoate metabolism
    A7A1_3476
   00660 C5-Branched dibasic acid metabolism
    A7A1_3476
Enzymes [BR:bsl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A7A1_3476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AGA24094
Position
complement(2388318..2389475)
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVESAKSLSSSVYVVKAQIHAGGRGKAGGV
KIAKSLDEVKAYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYIGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LSESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatatggggtatctgttcct
gaaggtaaagtggcttttacagcagaagaagcagttgagagtgcaaagagcttatccagc
tcggtttatgtcgtaaaggctcaaattcatgctggcggtcgaggcaaagctggtggggta
aaaatagcaaaatcattagacgaagtaaaagcgtatgccgaagaactattagggaagacc
ctagttacacatcagacgggtccggacggccaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaagaatattacatcggtctagtgcttgaccgcgccacttcaaga
atcgttttaatggcttctgaagaaggcggaacggaaattgaagaggttgcggagaaaaca
ccagaaaaaatcaaaaaagctgtcattgatccggctgttggccttcaaggctatcaagcc
agagaaattgcattcgctattaatattccaaaagagctcgtgggaaaagctgctaaattt
atgcttggactatataaagcgtttgttgagaaagactgctcaatcgccgaaatcaatccg
cttgttgtgactggcgacggaaatgtgatggcgcttgatgcaaaattgaattttgacagc
aatgcgttgtaccgacaaaaggacattatggaatacagagatttggatgaagaagatccg
aaagaaattgaagcgtccaaatatgatctaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggacttgcaatgtctacgatggatattatcaagcattatgga
ggagaaccggccaacttccttgatgtgggcggcggtgcaaccgcggaaaaagtcacggaa
gcatttaaaatcattctttctgatcaaaacgttaaagggatttttgtcaacattttcggc
ggcattatgaaatgtgatgtcatcgcagaaggggttgttgaagcgactagacaagttggt
ttgacattgccgcttgtcgtccgtcttgaaggcacaaacgtggatctagggaagaaaatc
cttagtgaatcaggattaaacattacatctgcggaatcaatggctgacggcgcgcagaaa
atcgtatccttagtttaa

DBGET integrated database retrieval system