KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3556Help
Entry
A7A1_3556         CDS       T02384                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A7A1_3556
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7A1_3556
   00052 Galactose metabolism
    A7A1_3556
   00500 Starch and sucrose metabolism
    A7A1_3556
   00520 Amino sugar and nucleotide sugar metabolism
    A7A1_3556
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A7A1_3556
   00524 Butirosin and neomycin biosynthesis
    A7A1_3556
Enzymes [BR:bsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A7A1_3556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1629619..1630584
Genome map
AA seq 321 aa AA seqDB search
MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKTGDTITVTIAKTIDGKLDELQKP
KHIIKYIGMGAPGPVDMAAGVVYETVNLGWENYALKNHLETETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIANGEIVHGINGAGGEIGHICSIPEGGAPCNCGKT
GCIETIASATGIVRIAKEKIANAKKTTRLKATEQLSARDVFEAAGENDEIALEVVDYVAK
HLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAFPRAAQAADISIAALGN
DAGVIGGAWIAKNEWLKHQNC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacgagatatggtttgcgggcattgacctgggaggaacgacgattaaactcgctttt
attaatcaatatggcgaaattcagcataagtgggaagttccgactgataaaaccggcgac
acgattactgtcacaattgcaaaaactatcgacggcaagctggatgagctgcaaaaaccg
aagcacatcatcaaatacatcggaatgggtgcaccaggccctgtagatatggcggcagga
gttgtttatgaaacagtaaatctagggtgggaaaattatgctttgaaaaaccatctggag
acagaaaccggcatcccagctgttatagaaaatgacgcgaatattgctgcgctcggggaa
atgtggaagggagcgggtgatggcgcaaaagacgtcattctcgtgacgcttggcacagga
gttggcggcggcatcattgcaaatggtgaaattgtacatggcataaatggcgccggcgga
gaaatcggccatatttgcagcatccctgaaggcggagcgccctgcaactgcggcaaaacg
ggctgtatcgaaacaattgcgtcagcaaccggaattgtaagaattgcaaaagaaaaaata
gcaaatgctaaaaagacgacacgtttaaaagcaaccgaacaattgtcagcgcgggatgtg
tttgaagcggcgggtgaaaatgatgaaattgcccttgaggtggttgattatgtagccaag
catcttggtttggtgctcggaaatttggcaagctcgcttaatccatccaaaatcgttctt
ggcggcggcgtatcgagagccggagaactgctgagatcaaaagtcgagaaaacattccgc
aaatgcgcgtttccgcgggcagcccaagctgctgatatttcaatcgcagcacttggaaat
gatgccggcgttatcggaggcgcttggatcgctaaaaatgaatggctgaaacatcaaaat
tgttaa

DBGET integrated database retrieval system