KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3786Help
Entry
A7A1_3786         CDS       T02384                                 

Definition
Alkaline phosphatase 4 (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A7A1_3786
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A7A1_3786
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A7A1_3786
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A7A1_3786
Exosome [BR:bsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7A1_3786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3056956..3058341
Genome map
AA seq 461 aa AA seqDB search
MKKMSLFQNMKSKLLPIAAVSVLTAGIFAGAELQQTEKASAKKQDKAEIRNVIVMIGDGM
GTPYIRAYRSMKNNGDTPNNPKLTEFDRNLTGMMMTHPDDPDYNITDSAAAGTALATGVK
TYNNAIGVDKNGKKVKSVLEEAKQQGKSTGLVATSEINHATPAAYGAHNESRKNMDQIAN
SYMDDKIKGKHKIDVLLGGGKSYFNRKDRNLTKEFKQAGYSYVTTKQALKKNKDQQVLGL
FADGGLAKALDRDSKTPSLKDMTVSAIDRLNQNKKGFFLMVEGSQIDWAAHDNDTVGAMS
EVKDFEQAYKAAIEFAKKDKHTLVIATADHTTGGFTIGANGEKNWHAEPILAAKKTPEFM
AKKINEGKPAKDVLARYGNLKVTSEEIKSVEAAAQADKSKGAYKAIIKIFNTRSNSGWTS
TDHTGEEVPVYAYGPGKEKFRGLINNTDQANIIFKILKTGK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgagtttgtttcaaaatatgaaatcaaaacttctgccaatcgccgctgtt
tctgtccttacagctggaatctttgccggagctgagcttcagcaaacagaaaaggccagc
gccaaaaaacaagacaaagctgagatcagaaatgtcattgtgatgataggcgacggcatg
gggacgccttacataagagcctaccgttccatgaaaaataacggtgacacaccgaataac
ccgaagttaacagaatttgaccggaacctgacaggcatgatgatgacgcatccggatgac
cctgactataatattacagattcagcagcagccggaacagcattagcgacaggcgttaag
acatataacaatgcaattggcgtcgataaaaacggaaaaaaagtgaaatcagtacttgaa
gaggccaaacagcaaggcaagtcaacagggcttgtcgccacgtctgaaattaaccacgcc
actccagccgcatatggcgcccacaatgaatcacggaaaaacatggaccaaatcgccaac
agctatatggatgacaaaataaaaggcaaacataaaatagacgttttgcttggcggcgga
aaatcttattttaaccgcaaggacagaaacttgacaaaggaattcaaacaagccggctac
agctatgtgacaactaaacaagcattgaaaaaaaataaagatcagcaggtgctcgggctt
ttcgcagatggagggcttgctaaggcgctcgaccgtgacagcaaaacaccgtctctcaaa
gacatgacggtttcagcaattgatcgcctgaaccaaaataaaaaaggatttttcttgatg
gtcgaagggagccagattgactgggctgcccatgacaatgatacagtaggagccatgagc
gaggttaaagattttgaacaggcctataaagccgcgattgaatttgcgaaaaaagacaaa
catacacttgtgattgcaactgctgaccatacaaccggcggctttaccattggcgcaaac
ggggaaaagaattggcacgcagaaccgattctcgccgccaaaaaaacccctgaatttatg
gcaaagaaaatcaatgagggcaaaccggcaaaagatgtgctcgcccgctatggcaatctg
aaagtcacatctgaagaaatcaaaagcgttgaagcagctgcacaggctgacaaaagcaaa
ggggcctacaaagccatcatcaagatttttaatactcgctccaacagcggatggacgagt
accgatcataccggcgaagaagtaccggtatacgcgtacggccccggaaaagaaaaattc
cgcggattgattaacaatacggaccaggcaaacatcatatttaagattttaaaaactgga
aaataa

DBGET integrated database retrieval system