KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3798Help
Entry
A7A1_3798         CDS       T02384                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    A7A1_3798
Enzymes [BR:bsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     A7A1_3798
Exosome [BR:bsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7A1_3798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3070593..3072083)
Genome map
AA seq 496 aa AA seqDB search
METYILSLDQGTTSSRAILFNKEGKIVHSAQKEFTQYFPHPGWVEHNANEIWGSVLAVIA
SVISESGISASQIAGIGITNQRETTVVWDKDTGSPVYNAIVWQSRQTSGICEELREKGYN
DKFREKTGLLIDPYFSGTKVKWILDNVEGAREKAEKGELLFGTIDTWLIWKMSGGKAHVT
DYSNASRTLMFNIYDLKWDDELLDILGVPKSMLPEVKPSSHVYAETVDYHFFGKNIPIAG
AAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAIKSEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGLRMFQDSSLSESYAEKVDSTDGVYVVPAFVGLGTPYWDSDVR
GSVFGLTRGTTKEHFIRATLESLAYQTKDVLDAMEADSNISLKTLRVDGGAVKNNFLMQF
QGDLLNVPVERPEINETTALGAAYLAGIAVGFWKDRSEIANQWNLDKRFEPELEEEKRNE
LYKGWQKAVKAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgtacattttatccttagatcaggggacgacaagttcaagagcgattctgttt
aataaagaaggcaaaattgtccactctgctcaaaaggaatttacacaatacttcccgcat
cctggctgggttgagcataatgccaatgaaatttggggctctgtcctcgcggttatcgcc
tcagtcatctctgaatcaggaatcagcgcttctcaaattgccggcatcggcatcacgaac
cagcgcgagacgacggttgtgtgggataaagatacaggaagtcctgtctataatgcaatc
gtttggcagtccagacagacgtccggcatttgtgaggaacttcgtgaaaaaggatataat
gataaattcagagaaaaaactgggcttttaatcgatccatacttctccggcacgaaggtg
aagtggattttagacaatgtggaaggcgcgagagaaaaagcggaaaaaggcgagctgctg
tttggaacgattgatacgtggctcatttggaaaatgtcaggcggaaaagcgcatgtgacc
gattactccaatgcctcaagaacactgatgtttaatatttacgatttaaaatgggacgat
gaactgctcgacattctaggcgtaccgaaatccatgctccctgaagtgaagccgtcctct
catgtgtatgcggagactgttgattatcacttcttcggaaaaaatatcccgattgctgga
gcggcaggcgaccagcagtccgcattgttcggccaggcatgctttgaagaaggcatgggg
aaaaacacttacggcacaggatgtttcatgctgatgaataccggggaaaaagcaattaag
tccgaacatgggcttttgacaacaatcgcttggggcattgacggaaaagtgaactatgcg
ttagaaggaagcatttttgtcgcaggctctgccatccagtggcttagagacggtttgaga
atgttccaggattcatcgctaagcgaatcttatgcagaaaaagtggattcaactgacggc
gtgtatgtcgttccggcctttgtcggactgggaacgccttactgggacagcgatgtgcgc
ggttcggttttcggcctgacaagagggacaacaaaagagcactttatccgtgcgacactg
gagtcattggcttatcagacaaaagatgtgcttgacgcaatggaagcagattcaaacatt
tcattaaagacgcttcgtgtagacggaggagctgtaaaaaacaatttcctaatgcagttc
caaggagacctgttgaatgttcctgtggagcgcccggaaattaatgaaacgactgcactt
ggcgcggcttatttggcaggtatcgctgtgggattctggaaggaccgttctgaaatcgcg
aaccagtggaatctggataaacggtttgagcctgaattggaagaagaaaaacgaaatgag
ctgtataaaggctggcaaaaagccgtgaaagcagctatggcttttaaataa

DBGET integrated database retrieval system