KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3798Help
Entry
A7A1_3798         CDS       T02384                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bsl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3070593..3072083)
Genome map
AA seq 496 aa AA seqDB search
METYILSLDQGTTSSRAILFNKEGKIVHSAQKEFTQYFPHPGWVEHNANEIWGSVLAVIA
SVISESGISASQIAGIGITNQRETTVVWDKDTGSPVYNAIVWQSRQTSGICEELREKGYN
DKFREKTGLLIDPYFSGTKVKWILDNVEGAREKAEKGELLFGTIDTWLIWKMSGGKAHVT
DYSNASRTLMFNIYDLKWDDELLDILGVPKSMLPEVKPSSHVYAETVDYHFFGKNIPIAG
AAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAIKSEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGLRMFQDSSLSESYAEKVDSTDGVYVVPAFVGLGTPYWDSDVR
GSVFGLTRGTTKEHFIRATLESLAYQTKDVLDAMEADSNISLKTLRVDGGAVKNNFLMQF
QGDLLNVPVERPEINETTALGAAYLAGIAVGFWKDRSEIANQWNLDKRFEPELEEEKRNE
LYKGWQKAVKAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgtacattttatccttagatcaggggacgacaagttcaagagcgattctgttt
aataaagaaggcaaaattgtccactctgctcaaaaggaatttacacaatacttcccgcat
cctggctgggttgagcataatgccaatgaaatttggggctctgtcctcgcggttatcgcc
tcagtcatctctgaatcaggaatcagcgcttctcaaattgccggcatcggcatcacgaac
cagcgcgagacgacggttgtgtgggataaagatacaggaagtcctgtctataatgcaatc
gtttggcagtccagacagacgtccggcatttgtgaggaacttcgtgaaaaaggatataat
gataaattcagagaaaaaactgggcttttaatcgatccatacttctccggcacgaaggtg
aagtggattttagacaatgtggaaggcgcgagagaaaaagcggaaaaaggcgagctgctg
tttggaacgattgatacgtggctcatttggaaaatgtcaggcggaaaagcgcatgtgacc
gattactccaatgcctcaagaacactgatgtttaatatttacgatttaaaatgggacgat
gaactgctcgacattctaggcgtaccgaaatccatgctccctgaagtgaagccgtcctct
catgtgtatgcggagactgttgattatcacttcttcggaaaaaatatcccgattgctgga
gcggcaggcgaccagcagtccgcattgttcggccaggcatgctttgaagaaggcatgggg
aaaaacacttacggcacaggatgtttcatgctgatgaataccggggaaaaagcaattaag
tccgaacatgggcttttgacaacaatcgcttggggcattgacggaaaagtgaactatgcg
ttagaaggaagcatttttgtcgcaggctctgccatccagtggcttagagacggtttgaga
atgttccaggattcatcgctaagcgaatcttatgcagaaaaagtggattcaactgacggc
gtgtatgtcgttccggcctttgtcggactgggaacgccttactgggacagcgatgtgcgc
ggttcggttttcggcctgacaagagggacaacaaaagagcactttatccgtgcgacactg
gagtcattggcttatcagacaaaagatgtgcttgacgcaatggaagcagattcaaacatt
tcattaaagacgcttcgtgtagacggaggagctgtaaaaaacaatttcctaatgcagttc
caaggagacctgttgaatgttcctgtggagcgcccggaaattaatgaaacgactgcactt
ggcgcggcttatttggcaggtatcgctgtgggattctggaaggaccgttctgaaatcgcg
aaccagtggaatctggataaacggtttgagcctgaattggaagaagaaaaacgaaatgag
ctgtataaaggctggcaaaaagccgtgaaagcagctatggcttttaaataa

DBGET integrated database retrieval system