KEGG   Bacillus subtilis BSn5: BSn5_01025Help
Entry
BSn5_01025        CDS       T01417                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSn5_01025
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSn5_01025
  Amino acid metabolism
   00310 Lysine degradation
    BSn5_01025
Enzymes [BR:bsn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BSn5_01025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(219009..220262)
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLQEVLK
DSGDTVQVGEIIGTISEGAGESSAPAPTEKTESKESVKEEKQAEPAAQEVSEEAQSEAKS
RTIASPSARKLAREKGIDLSQVPTGDPLGRVRKQDVEAYEKPASKPAPQQKQQPQAQKAQ
QSFDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFFEQNE
VKLGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAADEGLVVPVVRDADR
LTFAGIEKEIGELAKKARNNKLTLSELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMH
KIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacaatagcccaa
tggttaaagcagcctggtgactatgtagaacagggtgaatatctgcttgaactagaaacg
gataaagtgaatgttgaattgacagcagaagaatcgggtgtacttcaagaggtattgaaa
gattcgggtgataccgtccaggtcggagaaattatcggtacgatttcagaaggcgcgggt
gaaagttctgcccctgctcctacagagaaaacagaaagcaaggaaagcgtaaaagaagag
aaacaggctgaaccagctgcacaagaggtgagcgaggaagcacaatctgaagcaaaatca
agaacgatcgcttctccgtcggcccgtaagcttgcgagagaaaaaggaattgacctgtct
caagttccaactggagatccgcttggaagagtgcgcaagcaggatgtcgaagcgtacgaa
aaaccggcatcaaaaccggctcctcagcaaaagcagcagcctcaggctcaaaaagcacag
caaagctttgacaaacctgttgaagtgcaaaaaatgtcacgccgcagacaaacgattgca
aaacgccttgtagaggtacagcaaacatcagcgatgctgactacatttaatgaagtggac
atgacggctgtcatgaatctcagaaaacgccgcaaagatcaattttttgagcaaaatgaa
gtgaagctcggctttatgtctttcttcacgaaagcggtcgtggctgcattgaaaaaatat
ccgctgttgaatgcagaaattcaaggcgatgagttgatcgttaaaaaattctacgatatc
ggaatcgctgttgctgctgatgaaggccttgtcgttccggttgtacgggatgcggatcgc
ctgacatttgcaggaatcgaaaaagagatcggcgagcttgcgaaaaaagcaagaaacaat
aaattaacccttagcgagcttcagggaggctccttcacgattacaaacggagggactttc
ggttcattgatgtcaactccaattttaaacagcccgcaagtcggtatactgggcatgcat
aagattcagctgcgccctgtagccattgatgaagagcgtttcgaaaaccgtccgatgatg
tatatcgctttatcttatgatcaccgaattgtagacggtaaagaagcggttggtttcctc
gtgacaatcaaaaatttactggaagatcctgaacagcttttattagaaggataa

DBGET integrated database retrieval system