KEGG   Bacillus subtilis BSn5: BSn5_01790Help
Entry
BSn5_01790        CDS       T01417                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSn5_01790 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSn5_01790 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSn5_01790 (trpA)
Enzymes [BR:bsn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BSn5_01790 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(348566..349369)
Genome map
AA seq 267 aa AA seqDB search
MFKLDLQPTEKLFIPFITAGDPVPEVSIELAKSLQKAGATALELGVAYSDPLADGPVIQR
ASKRALDQGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLNKEYFFALLRENHIDGL
LVPDLPLEESNSLQEECKSHEVTYISLVAPTSESRLKTIIEQAEGFVYCVSSLGVTGVRN
EFNSSVYPFIRTVKNLSAVPVAVGFGISNREQVIKMNEISDGVVVGSALVRKIEELKDRL
ISAETRNQALQEFEDYAMAFSGLYSLK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattggatcttcaaccaacagaaaaattgtttatcccgtttattacggcgggc
gatccagttcctgaggtttcgattgaactggcgaagtcactccaaaaagcaggcgccact
gcattggagcttggtgttgcatactctgacccgcttgcagacggtccggtgatccagagg
gcttcaaagcgggcacttgatcaaggaatgaatatcgtaaaggcaatcgaattaggcgga
gaaatgaaaaaaaacggagtgaatattccgattatcctctttacgtattataatcctgtg
ttacaattgaacaaagaatactttttcgctttactgcgggaaaatcatattgacggtctg
cttgttccggatctgccattagaagaaagcaacagccttcaagaggaatgtaaaagccat
gaggtgacgtatatttctttggttgcgccgacaagcgaaagccgtttgaaaaccattatt
gaacaagccgaggggttcgtctactgtgtatcttctctgggtgtgaccggtgtccgcaat
gagttcaattcatccgtgtacccgttcattcgtactgtgaagaatctcagcgctgttccg
gttgctgtagggttcggtatatcaaaccgtgaacaggtcataaagatgaatgaaattagt
gacggtgtcgtagtgggaagtgcgctcgtcagaaaaatagaagaattaaaggaccggctc
atcagcgctgaaacgagaaatcaggcgctgcaggagtttgaggattatgcaatggcgttt
agcggcttgtacagtttaaaatga

DBGET integrated database retrieval system