KEGG   Bacillus subtilis BSn5: BSn5_01795Help
Entry
BSn5_01795        CDS       T01417                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BSn5_01795
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSn5_01795
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSn5_01795
Enzymes [BR:bsn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BSn5_01795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(349362..350564)
Genome map
AA seq 400 aa AA seqDB search
MYPYPNEIGRYGDFGGKFVPETLMQPLDEIETAFKQIKDDPAFREEYYKLLKDYSGRPTA
LTYADRVTEYLGGAKIYLKREDLNHTGSHKINNALGQALLAKKMGKTKIIAETGAGQHGV
AAATVAAKFGFSCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEAIRYW
VQHCEDHFYMIGSVVGPHPYPQVVREFQKMIGEEAKDQLKRIEGTLPDKVVACVGGGSNA
MGMFQAFLNEDVELIGAEAAGKGIDTPLHAATISKGTVGVIHGSLTYLIQDEFGQIIEPY
SISAGLDYPGIGPEHAYLHKSGRVTYDSITDEEAVDALKLLSEKEGILPAIESAHALAKA
FKLAKGMDRGQLILVCLSGRGDKDVNTLMNVLEEEVKAHV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatatccgaatgaaataggcagatacggtgattttggcggaaagtttgttccg
gaaacactcatgcagccgttagatgaaatagaaacagcatttaaacaaatcaaggatgat
cccgcttttcgtgaagagtattataagctgttaaaggactattccggacggccgactgca
ttaacatacgctgatcgagtcactgaatacttaggcggcgcgaaaatctatttgaaacga
gaagatttaaaccatacaggttctcataaaatcaataatgcgctaggtcaagcgctgctt
gctaaaaaaatgggcaaaacgaaaatcattgctgaaaccggtgccggccagcatggcgtt
gccgctgcaacagttgcagccaaattcggcttttcctgtactgtgtttatgggtgaagag
gatgttgcccgccagtctctgaacgttttccgcatgaagcttcttggagcggaggtagtg
cctgtaacaagcggaaacggaacattgaaggatgccacaaatgaggcgatccggtactgg
gttcagcattgtgaggatcacttttatatgattggatcagttgtcggcccgcatccttat
ccgcaagtggtccgtgaatttcaaaaaatgatcggagaggaagcgaaggatcagttgaaa
cgtattgaaggcactctgcctgataaagtagtggcatgtgtaggcggaggaagcaatgcg
atgggtatgtttcaggcatttttaaatgaagatgttgaactgatcggcgctgaagcagca
ggaaaaggaattgatacgcctcttcatgccgccactatttcgaaaggaaccgtaggggtt
attcacggttcattgacttatctcattcaggatgagttcgggcaaattattgagccctac
tctatttcagccggtctcgactatcctggaatcggtccggagcatgcatacttgcataag
agcggccgtgtcacttatgacagtatcactgatgaagaagcggtggatgcattaaagctt
ttgtcagaaaaagaggggattttgccggcaatcgaatctgcccatgcgttagcgaaagca
ttcaaactcgccaaaggaatggatcgcggtcaactcattctcgtctgtttatcaggacgg
ggagacaaggatgtcaacacattaatgaatgtattggaagaagaggtgaaagcccatgtt
taa

DBGET integrated database retrieval system