KEGG   Bacillus subtilis BSn5: BSn5_04535Help
Entry
BSn5_04535        CDS       T01417                                 

Definition
putative exonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BSn5_04535
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BSn5_04535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(814670..817066)
Genome map
AA seq 798 aa AA seqDB search
MQQHPDQLKLEEEPYLKGTVNTVIYHNDTNLYTVLKVKVTETSEAIEDKAVSVTGYFPAL
QEEETYTFYGKIVTHPKFGLQFQAEHFKKEIPTTKEGIIQYLSSDLFEGIGKKTAEEIVK
KLGDSAINKILADASVLYDVPRLSKKKADTLAGALQRHQGLEQIMISLNQFGFGPQLSMK
IYQAYESETLEKIQENPYQLVKDVEGIGFGKADELGSRMGLSGNHPERVKAAILYTLETT
CLSEGHTYIETEQLIIDTQSLLNQSAREGQRITEMDAANAIIALGENKDIVIEDGRCYFP
SLFYAEQNVAKRVKHIASQTEYENQFPESEFLLALGELEERMNVQYAPSQKEAIQKALSS
PMLLLTGGPGTGKTTVIRGIVELYGELHGVSLDPSAYKKDEAFPIVLAAPTGRAAKRMSE
STGLPAVTIHRLLGWNGAEGFTHTEDQPIEGKLLIIDEASMLDIWLANHLFKAIPDHIQI
IIVGDEDQLPSVGPGQVLRDLLASQVIPTVRLTDIYRQAEGSSIVELAHQMKNGLLPNNL
TAPTKDRSFIRCGGSQIKEVVEKVVANALKKGYTAKDIQVLAPMYRGKAGINELNVMLQD
ILNPPKEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEITSIFYAKENTEKEDMA
VVSFDGNEMTFTKKDFNQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAIT
RAKKFLILCGEEEALEWGVKNNDATVRQTSLKNRLSVQVEEMDAELEALQKELPFSVHDA
NIGMEGITPFDFMKEEQQ
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagcatccggatcagcttaaactggaggaagagccctatttaaaagggacagtc
aacacagtcatctatcataatgacaccaatttatatacggttctgaaagtgaaagtcaca
gagacctccgaagccattgaagataaagccgtatccgtgacgggctacttccctgcgctt
caagaagaagagacctacacgttttacggaaagatcgtaacccatccaaagttcgggctc
caatttcaggcggagcatttcaaaaaggagattccaacgactaaggaaggcatcattcaa
tatttatcgagtgatttattcgaggggatcggcaaaaaaacagctgaagaaattgtgaaa
aagctgggcgacagcgccattaataaaatattggctgatgcttcagtgctttatgatgtt
cccagactctcaaaaaagaaagccgacacgctggctggcgcattgcagcggcatcaggga
ctggagcaaatcatgatttccttgaatcagtttggctttggcccgcagctgtctatgaaa
atctatcaagcctatgaatccgagacgcttgaaaagattcaggaaaatccttatcagctt
gtgaaggatgtagaaggcatcgggtttgggaaagcggatgagctgggcagcagaatgggt
ctttcgggtaaccatcctgagcgggtaaaagctgctattttgtacacgcttgaaacgact
tgtctgtcagaggggcacacgtacatagaaacggaacagctgatcatcgacactcaatca
ctgttaaaccagtcagcaagggaagggcagcgcatcacagaaatggatgccgctaacgcg
attattgcccttggagaaaataaagacattgtcatagaagatggccgctgttattttcct
tcgctgttttacgcagaacaaaacgttgcaaagcgtgtgaaacatatcgctagccaaacc
gaatatgagaaccagtttcccgaatcagagtttttgctcgcgttgggagaactggaagaa
cggatgaacgttcagtatgcccccagccagaaggaagcgattcaaaaagccctttcctcg
ccgatgcttcttttaacaggcggtcctggaacagggaaaacgacggtaatcagagggatt
gtcgagctctacggagagcttcacggtgtgtcactagatccgtcagcttataaaaaggat
gaagcttttccgattgttttggccgctccgacagggagagcagcaaaacggatgagtgaa
tcaacgggactccctgcagtcacgatacacaggctgcttggctggaacggtgctgaaggc
tttactcatacagaggatcagccgatcgaagggaagctgttaattatcgatgaagccagt
atgcttgatatttggctggcgaatcatttgttcaaggcgatccctgatcatatacaaatc
atcattgtcggagacgaagaccagctgccttctgtcggtccgggacaagtgctcagagac
ttgctggcatcccaggtgattccgactgtgagactgacagacatctatcgccaggcggag
gggtcatcaatcgtcgagcttgcccaccagatgaaaaatggattgctgccgaacaatttg
actgccccgacaaaggaccgttcctttattcgctgcggcgggtcgcaaatcaaagaagta
gttgagaaggttgtcgccaatgcattgaaaaaaggctatacagcaaaggacattcaggtc
ctcgctccgatgtacagaggaaaagccggcattaatgaattgaatgtgatgctgcaggac
attttaaatcctcctaaagaaaaacggagagaattgaagttcggggatgttgtctacaga
accggagataaaattttgcagcttgtcaatcagccggaaaacaatgtattcaacggagat
attggcgaaatcacgtcgatattttatgcaaaggaaaatacagaaaaagaagacatggcc
gttgtttcttttgatggcaatgaaatgacgtttacgaaaaaagattttaatcaatttacc
catgcgtattgctgttctattcataaatcgcagggaagtgaatttccgattgtggttttg
cctgttgtgaaaggctattatagaatgctcagaagaaaccttctttataccgcgattaca
agagcaaagaaatttctcattttatgcggtgaggaggaggcgctggagtggggcgtaaaa
aataatgatgcaactgtcagacagacctccttgaaaaacaggctgtccgtacaggttgag
gaaatggatgccgagcttgaagctttgcaaaaagagctcccgttcagcgtacacgacgcc
aacattggcatggaaggcattacaccattcgattttatgaaagaagaacagcaataa

DBGET integrated database retrieval system