KEGG   Bacillus subtilis BSn5: BSn5_05095Help
Entry
BSn5_05095        CDS       T01417                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00071  Fatty acid degradation
bsn00362  Benzoate degradation
bsn01100  Metabolic pathways
bsn01120  Microbial metabolism in diverse environments
bsn01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BSn5_05095
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSn5_05095
Enzymes [BR:bsn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BSn5_05095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADV93647
Position
complement(925688..926464)
Genome map
AA seq 258 aa AA seqDB search
MNAISLAVDQFVAVLTIHNPPANALSSRILEELSSCLDQCETDAGVRSIIIHGEGRFFSA
GADIKEFTSLKGNEDSSLLAEHGQQLMERIESFPKPIIAAIHGAALGGGLELAMACHIRI
AAEDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALELIGSGEPISGKEALDLGLVSIGA
KDEAEVIEKAKALAAKFAEKSPQTLASLLELLYSNKVYSYEGSLKLEAKRFGEAFESEDA
KEGIQAFLEKRKPQFKGE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaatttcacttgcggttgatcaatttgtggcagttttgacgattcacaatccg
ccggcaaacgcgctttcaagccggatattagaagagctgtcttcctgtcttgatcaatgt
gagacagatgcaggcgtacgaagcattatcattcacggcgagggaagatttttctcagcc
ggcgctgatattaaagaatttacatcgcttaaaggcaatgaggattcctcattgctcgct
gagcacggccagcagttaatggagagaatcgaaagttttccaaaaccgattatcgcagcg
attcacggcgctgctctcggaggcgggctggagcttgcaatggcctgtcacatcagaatc
gcggcagaagatgctaagctggggctcccggagcttaatctcggtatcattccaggtttt
gcggggacacagcgccttccgagatatgtcggtacagccaaagcactggagctcatcgga
tcaggagaaccgatatccggaaaagaagcgcttgatctcggacttgtctcaattggagcg
aaagatgaggcagaagtgattgaaaaagcaaaagcacttgccgctaagtttgcagagaaa
agtccgcaaacgctggcatctttgcttgaacttctttattccaacaaggtgtattcctat
gaaggcagcttaaagcttgaagcaaagcgatttggggaagcatttgagtcagaggacgcc
aaggaaggcatccaggcatttctcgaaaaaagaaagcctcagttcaaaggcgaataa

DBGET integrated database retrieval system