KEGG   Bacillus subtilis BSn5: BSn5_05240Help
Entry
BSn5_05240        CDS       T01417                                 

Definition
putative endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSn5_05240
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BSn5_05240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(958738..959823)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKDLTDAKGIPGNEREVRQVMKSYIEPFADEVTTDRLGSLIAKKTGAENG
PKIMIAGHLDEVGFMVTQITDKGFIRFQTVGGWWAQVMLAQRVTIVTKKGEITGVIGSKP
PHILSPEARKKSVEIKDMFIDIGASSREEALEWGVLPGDMVVPHFEFTVMNNEKFLLAKA
WDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGI
AGDTPGISEKEAQSKMGKGPQIIVYDASMVSHKGLRDAVVATAEEAGIPYQFDAIAGGGT
DSGAIHLTANGVPALSITIATRYIHTHAAILHRDDYENAVNLITEVIKKLDRKTVDEITY
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgaaacattgaccatgctgaaagatttaacagatgcaaaaggcata
ccgggcaatgaaagagaagtaaggcaagtgatgaaatcatacatagaaccatttgctgat
gaggtgacaacagatcgcctgggcagtttaattgccaaaaaaactggtgcagaaaacggt
ccgaaaattatgatcgccggacatttggatgaagtcggctttatggtgacacaaatcaca
gataaaggctttatccgttttcaaaccgttggcggatggtgggctcaggttatgcttgcc
cagcgcgtcaccattgtcacaaaaaaaggagaaatcacaggggttatcggatctaagccg
cctcatattttgtctcctgaagcaagaaaaaaatcagtggaaataaaagacatgtttatt
gatattggagcttcaagccgggaagaagccttggagtggggtgtactcccgggagatatg
gtcgttccgcattttgagtttacggtcatgaacaatgaaaaattcctactcgcaaaggcc
tgggacaaccgcatcggctgtgcgattgcaattgatgtgttaagaaacttacaaaacaca
gaccatccaaatatagtgtatggcgtcggaaccgtgcaggaggaagtcggcctgagggga
gcgaaaacggctgcgcacaccattcagcctgatattgcgtttggtgttgatgtaggaata
gcaggagacacgcctggcatttccgagaaggaagcgcagagcaaaatgggcaaaggcccg
cagattatcgtttacgatgcatccatggtctctcacaaaggtttgcgcgatgcagttgta
gccactgcggaggaagccggcattccgtaccaatttgatgccattgccggcggcggaact
gattcgggtgccatccatttgacggcaaatggcgttcctgcgctgtccattaccattgca
acccgctacattcatacgcatgcggccatactgcatcgtgatgattatgaaaacgcggta
aatttaattacagaagtcattaagaagttagaccgaaaaacggttgacgaaattacgtac
caataa

DBGET integrated database retrieval system