KEGG   Bacillus subtilis BSn5: BSn5_05425Help
Entry
BSn5_05425        CDS       T01417                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSn5_05425
   01230 Biosynthesis of amino acids
    BSn5_05425
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSn5_05425
   00030 Pentose phosphate pathway
    BSn5_05425
   00051 Fructose and mannose metabolism
    BSn5_05425
   00052 Galactose metabolism
    BSn5_05425
  Energy metabolism
   00680 Methane metabolism
    BSn5_05425
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BSn5_05425
Enzymes [BR:bsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BSn5_05425
Protein phosphatases and associated proteins [BR:bsn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BSn5_05425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(995099..996058)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIANLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatctatcatgacgttgaagtttacggtatttacaacgga
tacgcgggattgatcagcggaaagattgaaaagcttgaactcggatcagtaggcgatatt
atacatcgtggagggactaagctttatacggcgagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaagggatagcaaacttgaagaagcttggtattgaaggccttgttgttatc
ggcggagacggttcctatatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacaattgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgtgatacagcgacttctcat
gaacgtacatatgtaatcgaagtaatgggccgtcatgccggcgatatcgcattgtgggcc
ggtcttgcagggggcgcagaatcgatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaagcacagtattattattgtt
gccgaaggtgtaggcagcggtgttgaattcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtattgggccatatccagcgcggaggttctccgagtgctgctgac
cgtgtgttagcaagccgtctcggcgcatatgcagttgaactgctgcttgaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatactt
gagacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatctaa

DBGET integrated database retrieval system