KEGG   Bacillus subtilis BSn5: BSn5_05625Help
Entry
BSn5_05625        CDS       T01417                                 

Definition
putative acyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bsn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bsn00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bsn00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bsn00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bsn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1032188..1033777)
Genome map
AA seq 529 aa AA seqDB search
MLKREDLIAPMQYNLVNEMEKFSAAGQKTALLWEDESGKQESWSYEKLMEETNKIGAALA
DLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGAIV
YSEFIGAFRDVSTADKLITLSIGENDAGWKNLLSIEADGSQFKTADTTRDDMAFLSYTSG
TTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSGAT
GFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLDRFDLSALHSAVSAGEPLN
REVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTPIKPGSMGKPTPGNQVEIINEDGEIC
KPGEVGDIAVHLSTPALFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYFWFESRNDDI
IISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVKML
QNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgtgaagatttaattgcccctatgcaatataatttagtgaatgaaatggaa
aagttcagtgccgctggacaaaaaaccgctcttctgtgggaggacgagtcgggcaagcaa
gaatcttggtcgtatgaaaagctgatggaagaaacaaataaaatcggagcggccttagct
gatcttggatttaaaaagggagacaagctgattgtaatggttccgcgggtgcttgaagcc
tatgccgtttatttggctatcctgaaatcaggaatggttgtcattccgtgctccgaaatg
cttcgcgcaaaagatcttgaataccgcattgaacatgcagaggtaaaaggcgccatcgtc
tactcagaatttattggcgctttccgggatgtcagtacggctgacaaactgattacactg
tctattggtgaaaatgatgccggctggaaaaacctcttatctattgaagcggacggaagc
caatttaaaacagctgacacaacaagagatgatatggctttcttatcttatacatccggg
acaacaggtcagccgaaaggtgttgtacatacacatggatgggcatttgctcatttaaaa
acttctgccggcgcttggcttgacatttctgaaaaggatatcgtctgggcaactgctgcc
cctggctggcaaaagtgggtatggagtccgtttttagcggtgcttggcagcggagcaacc
ggttttgtgtaccacggcagattcaaagcagaaaaatatctagagcttttaaatcgctac
aaaatcaatgttttctgctgcacgccgacagaataccgcttaatggcgaaggttgaaggc
ttggaccgttttgatctttctgccctgcacagcgctgtttccgcaggtgagccgctcaac
cgtgaagtcattgatgttttccaaaagcactttggcattaaggtacgggacggatatggc
caaactgaaagcacgcttttggttggtgttttgaaagatacgcctattaaaccgggaagc
atgggaaaaccgacaccgggaaatcaggtggagatcataaatgaagacggtgaaatctgc
aaacctggtgaggttggcgatatcgctgttcacctcagtacgcctgcgctctttaaagag
tattttaaagatccggaaagaatgaaaacacaaattcgcggcgattatttcctaacggga
gacagagcaagaaaagatgaggaaggttacttctggtttgaaagccgaaatgacgatatt
attatcagctccggctatacgatcgggcctttcgaggtggaagacgcgcttgttaagcac
ccagaagtaaaagaatgtgctgttgtcgcaagccctgacgaaatcagaggctccatcgta
aaggcatatgttgtcctgcaaaatcatgaaaaacgcagtgatgagcttgtcaaaatgctg
caaaaccatgtgaagacgattaccgctccatacaaatatcctagagaaattgaatttgtg
gaaagcctgccgaaaacggcttctgcaaaaatcagacgagtggaattaagaaaacgtgaa
gaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system