KEGG   Bacillus subtilis BSn5: BSn5_05695Help
Entry
BSn5_05695        CDS       T01417                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00010  Glycolysis / Gluconeogenesis
bsn00620  Pyruvate metabolism
bsn00640  Propanoate metabolism
bsn00680  Methane metabolism
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
bsn01120  Microbial metabolism in diverse environments
bsn01130  Biosynthesis of antibiotics
bsn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSn5_05695
   00620 Pyruvate metabolism
    BSn5_05695
   00640 Propanoate metabolism
    BSn5_05695
  Energy metabolism
   00680 Methane metabolism
    BSn5_05695
Enzymes [BR:bsn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BSn5_05695
Lipid biosynthesis proteins [BR:bsn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BSn5_05695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADV93767
Position
complement(1046734..1048452)
Genome map
AA seq 572 aa AA seqDB search
MNLKALPAIEGDHNLKNYEETYRHFDWAEAEKHFSWHETGKLNAAYEAIDRHAESFRKNK
VALYYKDAKRDEKYTFKEMKEESNRAGNVLRRYGNVEKGDRVFIFMPRSPELYFIMLGAI
KIGAIAGPLFEAFMEGAVKDRLENSEAKVVVTTPELLERIPVDKLPHLQHVFVVGGEAES
GTNIINYDEAAKQESTRLDIEWMDKKDGFLLHYTSGSTGTPKGVLHVHEAMIQQYQTGKW
VLDLKEEDIYWCTADPGWVTGTVYGIFAPWLNGATNVIVGGRFSPESWYGTIEQLGVNVW
YSAPTAFRMLMGAGDEMAAKYDLTSLRHVLSVGEPLNPEVIRWGHKVFNKRIHDTWWMTE
TGSQLICNYPCMDIKPGSMGKPIPGVEAAIVDNQGNELPPYRMGNLAIKKGWPSMMHTIW
NNPEKYESYFMPGGWYVSGDSAYMDEEGYFWFQGRVDDVIMTSGERVGPFEVESKLVEHP
AIAEAGVIGKPDPVRGEIIKAFIALREGFEPSDKLKEEIRLFVKQGLAAHAAPREIEFKD
KLPKTRSGKIMRRVLKAWELNLPAGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaaagcgttaccagcaatagagggggatcataacttaaaaaactatgaagaa
acgtaccggcattttgattgggccgaggcagagaaacatttctcttggcatgagacaggg
aaactgaatgcggcgtatgaagcgattgaccgccatgccgaatcgtttcgaaaaaacaaa
gtagcgctttattataaagacgcaaaaagggatgaaaaatacacatttaaagaaatgaag
gaagaatcaaacagagccgggaatgtgctgagacggtatggaaatgtggaaaaaggggac
cgcgtttttatttttatgccgagatcacccgagctttattttattatgcttggcgcaatc
aaaattggcgccatcgccgggccgctgttcgaagcatttatggagggagcggtgaaagat
cggcttgaaaacagtgaggcaaaggttgttgtcacaacacctgagctgctggagagaata
ccggtagacaaactgcctcacttgcagcatgtcttcgtagtcgggggagaggctgagagc
ggcacgaatatcatcaattatgatgaagcagcgaaacaggaaagcacaagactggatatc
gaatggatggataaaaaagacggctttctgcttcactatacatcaggttccactggtacg
ccaaagggcgtgctgcatgtccatgaagcgatgattcagcaatatcaaacaggaaagtgg
gtccttgatttaaaggaagaagacatttattggtgcacggctgatccaggctgggtgaca
ggtacggtatacggcatttttgcaccgtggctgaacggagcgacaaatgtcatcgtcggc
ggacgtttcagcccggaaagctggtatggtacgattgaacagcttggcgtcaatgtctgg
tacagcgcgccgaccgcttttcggatgctgatgggagcgggagatgaaatggctgcgaaa
tatgatctaacttcactccggcatgtgctcagtgtcggtgagccgctaaatccggaagtc
atcagatggggacataaagtttttaacaaacgaattcatgatacatggtggatgacagaa
acgggcagtcagcttatctgcaactatccttgcatggatattaaaccgggttcaatgggt
aagccgattccaggagtggaggcagcgatcgttgacaatcaaggcaacgagcttccgccg
taccgaatgggcaatctcgccatcaaaaagggctggccttccatgatgcataccatttgg
aataaccctgaaaagtatgaatcgtatttcatgccgggcggctggtatgtgtctggggat
tctgcttacatggatgaagagggatacttttggttccaaggcagagttgatgacgtcatc
atgacctccggtgagcgcgtcggcccatttgaagtggaaagcaagcttgtcgaacatccg
gctattgcagaagcaggcgtaatcggaaagcctgacccggtgcgtggagaaatcattaaa
gcttttattgcactcagggaaggatttgagccgtctgataaactgaaagaagagatccgc
ctatttgtaaagcagggtcttgcagcccatgcggctccgcgtgagatcgaatttaaagat
aagcttccgaaaacccgaagcggaaagatcatgaggcgcgtgctgaaggcatgggagctt
aatctgccggctggagatctgtcaacaatggaggattaa

DBGET integrated database retrieval system