KEGG   Bacillus subtilis BSn5: BSn5_05990Help
Entry
BSn5_05990        CDS       T01417                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BSn5_05990
  Lipid metabolism
   00561 Glycerolipid metabolism
    BSn5_05990
   00600 Sphingolipid metabolism
    BSn5_05990
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BSn5_05990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109405..1110703
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDPKRLQESQLMLENLRDRYNPS
VAINSYDDRKLALQNAGYVINAIQVGGYKPSTVIDFEIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLIDIAKDMEEMCPDAWFLNYTNPMATLTGAMLRYTNIKTIGLCHSVQVCTKDLF
KALGMEHDGIEERIAGINHMAWLLEVKKDGTDLYPEIKRRAKEKQKTKHHDMVRFELMDK
FGYYVTESSEHNAEYHPYFIKRNYPELISELQIPLDEYPRRCVKQIENWEKMRDDIVNNK
NLTHERSKEYGSRIIEAMETNEPFTFGGNVLNTGLITNLPSKAVVEVTCVADRKKITPCF
AGELPEQLAALNRTNINTQLMTIEAAVTRKKEAVYQAAMLDPHTSAELSMKDIISMCDDL
FAAHGDWLPEYK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattacatttatcggtgcagggagcacgattttcgccaaaaatgttttggga
gactgcctattaacagaggcactgaatggatttgagttcgctctttacgacattgatccc
aaacgcctgcaggaatcccagctcatgctcgaaaatctaagagaccgttataacccaagt
gtggccatcaacagctatgatgacagaaaactcgccttgcaaaacgcaggctatgtcatc
aatgcgattcaggttggaggatacaaaccgagcacagtcatcgatttcgagattcctaaa
cggtatgggctgcgccagacgatcgccgatacagtaggcatcggcgggatattcagatct
ctcagaacaatcccggtcttaattgatatcgcaaaagatatggaggaaatgtgccctgac
gcatggttcttaaactatacaaatccaatggccactcttacaggcgccatgctccgctat
accaatatcaaaacaatcgggctctgccacagtgttcaagtgtgcacgaaggatttattt
aaagctctcggaatggagcatgacggaattgaggaacgcatcgcaggcattaatcatatg
gcttggcttttggaagtcaaaaaagacggcacagatttatatccagaaatcaaaaggaga
gcgaaagaaaaacaaaaaacaaagcatcatgatatggtgcggtttgaattaatggataag
ttcggctattatgtcacggaatcgtccgaacataacgcagagtatcacccatactttatt
aaacggaattaccctgaactgatcagcgagctgcaaatcccgctcgacgaatatccgaga
aggtgcgtcaagcagattgaaaattgggagaaaatgcgggatgatatcgtcaataataaa
aaccttacgcacgaacgctcaaaggaatatggttcaagaattatagaagcaatggaaaca
aacgaaccattcaccttcggaggaaacgtcttgaatacagggctgatcaccaaccttcct
tcaaaagcggttgtggaagtgacatgcgtcgccgacagaaaaaaaattacaccgtgcttc
gccggagaactgcctgagcagcttgcagccttaaaccgaacgaatattaatacacagctg
atgacaatcgaagcggctgtcacacgaaaaaaagaagcggtttaccaagctgcaatgctt
gatccgcatacaagcgcggagctttccatgaaggacatcatctccatgtgtgacgattta
tttgcagcacacggcgattggcttccggaatacaaataa

DBGET integrated database retrieval system