KEGG   Bacillus subtilis BSn5: BSn5_07890Help
Entry
BSn5_07890        CDS       T01417                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00010  Glycolysis / Gluconeogenesis
bsn00051  Fructose and mannose metabolism
bsn00562  Inositol phosphate metabolism
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
bsn01120  Microbial metabolism in diverse environments
bsn01130  Biosynthesis of antibiotics
bsn01200  Carbon metabolism
bsn01230  Biosynthesis of amino acids
Module
bsn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsn_M00002  Glycolysis, core module involving three-carbon compounds
bsn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSn5_07890 (tpiA)
   00051 Fructose and mannose metabolism
    BSn5_07890 (tpiA)
   00562 Inositol phosphate metabolism
    BSn5_07890 (tpiA)
Enzymes [BR:bsn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BSn5_07890 (tpiA)
Exosome [BR:bsn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BSn5_07890 (tpiA)
  Exosomal proteins of bladder cancer cells
   BSn5_07890 (tpiA)
  Exosomal proteins of melanoma cells
   BSn5_07890 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADV94204
Position
complement(1492431..1493192)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLASAVKGTDLK
VGAQNMHFEESGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKTVAESFSQEAADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatcgccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agcttcgttgaagaagtgaaatcttccattccagcagcagacaaagctgaagctgttgtt
tgcgcgccagcgcttttcttagaaaagcttgcttctgctgttaaaggcactgacctaaaa
gtcggcgctcaaaacatgcacttcgaagaaagcggcgcgttcacaggtgaaatcagcccg
gttgctctgaaagaccttggcgttgactactgcgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcacacgcagctttcaaacacggc
attgtgccgatcatctgtgtaggtgaaacgcttgaagagcgtgaagccggcaaaacaaat
gatcttgttgctgaccaagtgaaaaaaggccttgctggtctttctgaagaacaagttgct
gcttctgttattgcgtatgagccaatctgggcaatcggaacaggcaaatcttctacagcg
aaagatgcgaatgacgtgtgtgcgcatatccgtaaaaccgtcgctgaaagcttcagccaa
gaagctgcagacaagcttcgcatccaatatggcggaagcgtaaagcctgcaaacattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcgagccttgagcca
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system