KEGG   Bacillus subtilis BSn5: BSn5_08760Help
Entry
BSn5_08760        CDS       T01417                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSn5_08760
   00052 Galactose metabolism
    BSn5_08760
   00500 Starch and sucrose metabolism
    BSn5_08760
   00520 Amino sugar and nucleotide sugar metabolism
    BSn5_08760
Enzymes [BR:bsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSn5_08760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1673942..1674820
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEG
RRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLNEI
QRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMENLLNKEEI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgtaaagccataattccagcagcaggcttaggaacacgttttcttccg
gctacgaaagcaatgccgaaagaaatgcttcctatcgttgataaacctaccattcaatac
ataattgaagaagctgttgaagccggtattgaagatattattatcgtaacaggaaaaagc
aagcgtgcgattgaggatcattttgattactctcctgagcttgaaagaaacctagaagaa
aaaggaaaaactgagctgcttgaaaaagtgaaaaaggcttctaacctggctgacattcac
tatatccgccaaaaagaacctaaaggtctcggacatgctgtctggtgcgcacgcaacttt
atcggcgatgagccgtttgcggtactgcttggtgacgatattgttcaggctgaaactcca
gggttgcgccaattaatggatgaatatgaaaaaacactttcttctattatcggtgttcag
caggtgcccgaagaagaaacacaccgctacggcattattgacccgctgacaagtgaaggc
cgccgttatcaggtgaaaaacttcgttgaaaaaccgcctaaaggcacagcaccttctaat
cttgccatcttaggccgttacgtattcacgcctgagatcttcatgtatttagaagagcag
caggttggcgccggcggagaaattcagctcacagacgccattcaaaagctgaatgaaatt
caaagagtgtttgcttacgattttgaaggcaagcgttatgatgttggtgaaaagctcggc
tttatcacaacaactctagaatttgcgatgcaggataaagagcttcgcgatcagctcgtt
ccatttatggaaaacttattaaacaaagaagaaatctaa

DBGET integrated database retrieval system