KEGG   Bacillus subtilis BSn5: BSn5_08880Help
Entry
BSn5_08880        CDS       T01417                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSn5_08880
Enzymes [BR:bsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BSn5_08880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1703596..1704477
Genome map
AA seq 293 aa AA seqDB search
MRNICVIGSCSMDLVVTSDKRPKAGETVLGTSFQTVPGGKGANQAVAAARLGAQVFMVGK
VGDDHYGTAILNNLKANGVRTDYMEPVTHTESGTAHIVLAEGDNSIVVVKGANDDITPAY
ALNALEQIEKVDMVLIQQEIPEETVDEVCKYCHSHDIPIMLNPAPARPLKQETIDHATYL
TPNEHEASILFPELTISEALALYPAKLFITEGKQGVRYSAGSKEVLIPSFPVEPVDTTGA
GDTFNAAFAVALAEGKDIEAALRFANRAASLSVCSFGAQGGMPTRNKVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatatttgtgtgattggtagctgttctatggatttagtggtcacctcggacaaa
cgcccaaaagccggtgaaacggttcttggcacgtcatttcagactgtgccgggcggcaaa
ggagcaaatcaggccgttgccgcagccagacttggggctcaagtgtttatggtcggcaag
gttggagacgatcattatggaacagctattttgaataatctcaaagctaacggcgttcgc
actgactatatggaaccggttacacatacggaaagcggaaccgctcatattgtgcttgct
gaaggcgacaacagcattgtcgttgtcaaaggcgcgaacgatgacatcaccccagcgtat
gcgttaaacgcgctcgaacagattgaaaaggtcgatatggtgctgattcagcaggaaatc
ccagaagaaacggttgatgaggtgtgcaaatactgccattctcacgatatcccgatcatg
ctaaacccagcaccggcccgcccgctcaagcaggaaacaattgatcacgctacctatctg
acgccgaatgaacacgaggcttcgattttattccctgagcttaccatttctgaagctctg
gcgctttatccggcaaagctctttattacggaaggaaaacaaggcgtccgctattcggct
ggcagcaaagaggtgctcatcccgtccttccctgtagagcccgttgatacaaccggagcc
ggtgatacgtttaacgcagcatttgccgtggccctggctgagggaaaagacattgaagcc
gcattgcggtttgccaatcgtgccgcttccctttctgtctgctccttcggtgcccaaggc
ggaatgccgacaagaaataaagtagaggagctgctgtcatga

DBGET integrated database retrieval system