KEGG   Bacillus subtilis BSn5: BSn5_09900Help
Entry
BSn5_09900        CDS       T01417                                 

Definition
(GenBank) nucleotide sugar epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00521  Streptomycin biosynthesis
bsn00523  Polyketide sugar unit biosynthesis
bsn01130  Biosynthesis of antibiotics
Module
bsn_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BSn5_09900
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSn5_09900
Enzymes [BR:bsn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BSn5_09900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2
Motif
Other DBs
NCBI-ProteinID: ADV94600
Position
complement(1888172..1888627)
Genome map
AA seq 151 aa AA seqDB search
MIDGVKVKKLMKHSDDRGFFAELVRDDENLLEHFGQASWSKSYPGVIKAFHYHEKQDDLW
FFPTGHAQVVLYDLREDSKTKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTIIYF
TTMSYNPDQPDEKRIPWDDETIGFNWNTEFR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatggagtcaaggtgaaaaaattgatgaagcatagcgatgacagaggctttttt
gctgagctggtccgggacgatgagaatctccttgagcattttgggcaggcctcttggtcg
aaaagctatccgggtgtgattaaggcatttcattatcatgagaagcaggatgatctctgg
ttcttcccaaccggccacgctcaggttgtcctatacgatcttcgagaggattcaaagaca
aaaggagaaacggacgtctattatatgggcgaagacaacccgatgctgttattaatccca
aaaggggtggctcacggatatagagtgctgggagagacgccgctgacaattatctatttt
accaccatgtcgtataacccggatcagcctgatgaaaaaagaattccgtgggatgatgag
acgatcggttttaactggaacactgaattcagataa

DBGET integrated database retrieval system