KEGG   Bacillus subtilis BSn5: BSn5_09915Help
Entry
BSn5_09915        CDS       T01417                                 

Definition
putative dTDP-glucose pyrophosphorylase
Orthology
K00973  
glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bsn00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bsn00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1890432..1891172)
Genome map
AA seq 246 aa AA seqDB search
MKGVILAGGNGSRLMPLTKAVNKHLLPVGPYPMIYWSIMKLEEAGIKDILLISQKEHMPQ
FYKLLGNGEELGVTITYQVQPAASGISDGLSYAKRFTKKESFILLLGDNIFEDSLKPYTE
RFEQQGKGAKVLLKEVDDPERFGIAEIDEKNKRIRSIIEKPEQPPTNLCVTGIYMYDAKV
FSYIEQISPSKRGELEITDVNNLYIENSQLTYDVLSGWWVDAGTHESLYLASQLVHQALR
KGQDEK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggtgttattttagccggaggaaacggctcacgccttatgcccttaacgaaagcc
gtcaacaagcatttgcttcctgtaggcccgtatccgatgatatactggtcgattatgaag
ctggaggaagccggaataaaagacattttactcatcagccaaaaagagcatatgccgcaa
ttttataaactgcttggaaacggagaagagcttggcgttactatcacttatcaagtacag
ccggcagcatcgggcatttcggatgggctgtcttatgcaaagcgctttacgaaaaaagag
tctttcattttattattaggtgataatatttttgaagattcattaaagccttatacagaa
cgctttgaacagcaggggaaaggagcaaaagtgcttctgaaagaagttgatgacccagaa
cgcttcgggattgctgagattgatgagaaaaacaagcggattcgttccatcatcgaaaag
cccgaacagccaccgaccaacctttgtgttaccggcatttatatgtatgatgcaaaggtg
ttttcgtatattgaacaaatatcaccatcaaagcgcggcgagctggaaatcaccgatgtg
aataatctatacatcgaaaacagccagcttacgtatgatgtgttatcaggctggtgggta
gatgccggaactcacgaatcgctttatctcgcttcccagcttgtacaccaggctttacgg
aaaggacaggacgaaaagtga

DBGET integrated database retrieval system