KEGG   Bacillus subtilis BSn5: BSn5_11965Help
Entry
BSn5_11965        CDS       T01417                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSn5_11965
Enzymes [BR:bsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BSn5_11965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2302702..2303205
Genome map
AA seq 167 aa AA seqDB search
MNNIAYIALGSNIGDRETYLRQAVALLHQHAAVTVTKVSSIYETDPVGYEDQAQFLNMAV
EIKTSLNPFELLELTQQIENELGRTREVRWGPRTADLDILLFNRENIETEQLIVPHPRMY
ERLFVLAPLAEICQQVEKEATSAETDQEGVRVWKQKSGVDEFVHSES
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacatagcttatattgcacttggatctaatattggagatagagaaacgtattta
aggcaagcagtggctttactgcatcagcatgctgcggtgacagtcactaaagtgtcgtct
atttatgaaactgacccggtcggatacgaagatcaagctcaatttttgaatatggctgtt
gaaatcaagacatcactgaacccttttgaactccttgaactgacgcagcagatagaaaat
gaattaggcagaacaagggaagtaagatgggggccgcggacggcagaccttgacattttg
ttatttaatcgtgaaaatattgaaacagagcaactaattgttccgcatccgagaatgtat
gagcgtttgtttgtccttgcgccgcttgcggaaatttgccagcaggttgaaaaagaggct
acaagcgccgaaacagaccaagaaggtgtaagagtatggaagcagaaatctggggtagac
gaattcgtgcattcagaaagctga

DBGET integrated database retrieval system