KEGG   Bacillus subtilis BSn5: BSn5_12030Help
Entry
BSn5_12030        CDS       T01417                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bsn00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2325945..2327396
Genome map
AA seq 483 aa AA seqDB search
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDKKRNIEGGEQSQL
NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCYCTEEELEKERE
EQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGKIIAFNDIVKGEISFESD
GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIYQAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFIGLLGWSPVGEEELFTKEQF
IEIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVELTLPHLQKAGKVGTELSAEEQ
EWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAKAVLEEEQVPEVLSTFAAKLEE
LEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGKETAIQRL
KNI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaagtacgcgtccgttatgcaccgagtccaaccggacatttgcatattgga
aatgccagaacggcgctttttaattatttatttgcccgcaatcaaggcggtaagtttatc
attcgagttgaggatacagataaaaagcgcaatattgagggcggagaacaaagccagctg
aattatctgaagtggctaggtattgactgggatgagagtgtggatgtcggaggagagtac
ggcccataccgtcaatccgagcgtaacgatatctataaagtgtactatgaagagcttctt
gaaaaagggcttgcttataaatgttactgtacggaagaagagcttgaaaaagagcgtgaa
gaacagattgcccgcggagaaatgcctcgttattccggaaaacacagagacctgactcag
gaagaacaggagaaatttatcgctgaaggcagaaaaccaagtattcgtttccgcgtgccg
gaaggaaaaattatcgccttcaatgatatcgtaaaaggcgaaatttcttttgaatcagat
ggcatcggcgactttgttattgtgaaaaaggacggaacgccgacttacaacttcgcggta
gcgattgatgactacttaatgaaaatgacacacgtgctgcgcggtgaggatcatatttct
aacacaccgaaacagattatgatttatcaagcattcggatgggatattcctcagttcgga
cacatgacgctgattgtaaacgaaagccgtaaaaagctcagtaaacgtgatgaatccatt
attcaattcatcgagcagtacaaagagcttggctacctgccagaagcgctgttcaacttt
atcggactgctaggctggtcaccggttggagaagaagagcttttcacaaaagagcagttt
attgaaatttttgatgtaaatcgtttatctaaatcaccagctttgtttgatatgcataag
ctaaaatgggttaacaaccaatatgtgaagaagctggatcttgatcaggttgttgaattg
acgcttccgcatttgcaaaaagccggcaaagttggcactgagctttctgctgaagaacaa
gaatgggttcgtaaactgatttccctgtatcatgagcaattaagctacggtgcggaaatt
gttgagctgactgatttgttctttacggatgagatcgagtataatcaagaagcgaaagct
gttctggaagaagaacaggttcctgaagtgctcagtacattcgcagcgaagcttgaagag
cttgaagagttcactccggataacatcaaagcatcgatcaaagcagtgcagaaagaaact
ggccataaagggaaaaaactgtttatgccgattcgtgttgctgtaacagggcaaactcac
ggtccggaactgccgcaatcaattgaattgatcggtaaagagactgcaattcagcgttta
aaaaatatctaa

DBGET integrated database retrieval system