KEGG   Bacillus subtilis BSn5: BSn5_12420Help
Entry
BSn5_12420        CDS       T01417                                 

Definition
putative beta-hexosaminidase, putative lipoprotein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bsn  Bacillus subtilis BSn5
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSn5_12420
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BSn5_12420
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BSn5_12420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2401522..2403450)
Genome map
AA seq 642 aa AA seqDB search
MRPVFPLILSAVLFISCFFGARQTEASASKRAIDANQIVNRMSLDEKLGQMLMPDFRNWQ
KEGESSPQALTEMNDEVASLVKKYQFGGIILFAENVKTTKQTVQLTDDYQKANPKIPLML
SIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGSIIGKELSALGINTDFSPVVDIN
NNPDNPVIGVRSFSSNRELTSRLGLYTMKGLQRQDIASALKHFPGHGDTDVDSHYGLPLV
SHGQERLREVELYPFQKAIDAGADMVMTAHVQFPAFDDTTYKSKLDGSDILVPATLSKKV
MTGLLREEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVKAGVDIALMPASVTSMKEEQK
FARVIQALKEAVKNGDIPEQQINKSVERIISLKIKRGMYPAQNSDSTKEKIAKAQKIVGS
KQHLKAEKKIAEKAVTVLKNEQHTLPFKPKKGSRILIVAPYEEQTASIEQTIHDLIKRKK
IKPVSLSKMNFANQVFKAEHAKQVKKADYIITGSYVVKNDPVVNDGVIDDTISDSSKWAT
VFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKALIAVYGFKGYANGRYLQPNIPAGV
MAIFGQAKPKGTLPVNIPSVTKPGNTLYPFGYGLNIKTGRPL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgtctttccgcttatcctttcagccgttctctttatttcatgctttttcggg
gccagacagacagaagcctctgcatccaaacgtgcaatcgatgccaatcagattgtcaat
cgtatgtctttagatgaaaaactcggccagatgctgatgcctgattttagaaactggcaa
aaggaaggcgagtcctctccgcaagcccttacagaaatgaatgatgaagtcgccagcctc
gtcaagaaatatcaattcggaggcatcatcctttttgcagaaaatgtaaaaacaacaaaa
caaactgtccaactgacagacgattaccaaaaggcaaatccaaaaatcccgctcatgctg
agtattgatcaggaaggcggcattgtaacgcggttaggggagggcactaatttcccaggg
aatatggcgctgggcgcagccagaagcagaatcaatgcgtatcagaccggcagcatcatc
gggaaagagctctctgccttaggcatcaatacagatttcagccctgtcgtggacattaac
aataatcccgataatcctgtaatcggcgtacggtcattcagctccaatcgagaactgaca
tcacgcctcggtttatatacgatgaaagggttgcagcggcaggatatcgcctctgccctc
aaacatttcccgggacatggagacacggacgttgacagccattatggactgccgctcgtt
tcccatggccaagaacggcttcgtgaggtcgagctttatcctttccaaaaagcaattgat
gctggtgctgatatggtgatgacagcccatgttcagtttcccgcctttgatgacaccact
tacaaaagcaaactcgatgggtcggatattctggttccagctacactttcaaaaaaagtg
atgacaggtcttcttcgtgaggaaatgggctttaatggtgtgatcgttactgatgcgctc
aatatgaaggcaattgcagatcatttcggacaggaagaggctgtggtcatggccgtaaaa
gctggtgtcgatattgcattaatgccagcctcagtcacttcaatgaaagaagaacagaaa
ttcgcacgtgtcattcaagctttaaaagaagccgtaaaaaacggggatatccctgaacaa
caaatcaacaaatcagttgaaagaatcatttccctaaaaataaaacgcggcatgtatcct
gcgcaaaacagcgacagtacaaaagaaaaaatagccaaagcccaaaaaatcgtaggaagc
aagcagcacctcaaagcagagaaaaaaatagctgaaaaagcagtaactgtattaaaaaat
gaacagcacactttgccgttcaagcctaaaaaaggcagccgaatcttaattgtggcacct
tacgaagaacaaactgcttcaatcgaacaaaccattcacgatctcatcaagcgaaagaaa
atcaaacccgtatccctcagcaaaatgaactttgccaaccaagtatttaaggccgagcat
gcaaaacaagtaaaaaaggctgattatatcataaccggctcctatgtcgtcaaaaatgac
cctgtcgtcaacgacggtgtcatcgacgacacaatatcagattcaagcaaatgggccacc
gtgtttccgagagctgtcatgaaagccgcactgcagcacaacaaaccatttgtcttaatg
agcctgcgcaacccatatgatgccgccaatttcgaagaagcaaaggcactgattgcagtc
tatggctttaaaggatacgcaaatggccgttatcttcaacctaatattccggccggagtg
atggcgattttcggccaggcaaaacctaaaggcacacttccagttaacatcccatcagtc
acgaaaccagggaataccctttacccatttggctacggattaaatatcaaaacgggaaga
ccgctttaa

DBGET integrated database retrieval system