KEGG   Bacillus subtilis BSn5: BSn5_12890Help
Entry
BSn5_12890        CDS       T01417                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bsn00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bsn00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bsn02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2498508..2500259
Genome map
AA seq 583 aa AA seqDB search
MAYDSRFDEWVQKLKEESFQNNTFDRRKFIQGAGKIAGLSLGLTIAQSVGAFEVNAAPKF
SSYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPKQAVPVKWEVAKDEHFRKIVRKGT
EMAKPSLAHSVHVEADGLEPNKVYYYRFKTGHELSPVGKTKTLPAPGANVPQMTFAFASC
QQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHNSAEIITLQDYRN
RHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANKIPEKGQSVEAFVLRRAAAYQAYYE
HMPLRISSLPNGPDMQLYRHFTYGNLASFNVLDTRQYRDDQANNDGNKPPSDESRNPNRT
LLGKEQEQWLFNNLGSSTAHWNVLAQQIFFAKWNFGTSASPIYSMDSWDGYPAQRERVIN
FIKSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFGAEFVGTSITSGGNGADKRADTD
QILKENPHIKFFNDYRGYVRCTVTPHQWKADYRVMPFVTEPGAAISTRASFVYQKDQTGL
RKVSSTTIQGGVKQSDEVEEDRFFAHNKAHEKQMIKKRAKITN
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgacagtcgttttgatgaatgggtacagaaactgaaagaggaaagctttcaa
aacaatacgtttgaccgccgcaaatttattcaaggagcggggaagattgcaggactttct
cttggattaacgattgcccagtcggttggggcttttgaagtaaatgctgcgcctaaattc
tcaagctatccgtttacattaggggtagcgtcaggtgatccgctttctgacagtgtcgtg
ctctggacgcgcctggcaccagatccgctgaacggcggaggaatgccgaagcaagccgtg
cctgtcaaatgggaggtcgcaaaggatgagcatttccgcaaaatcgtaagaaaaggcact
gaaatggctaaaccgagtcttgcccattccgttcatgtggaagcagacgggcttgagccg
aacaaagtgtactattaccgtttcaaaaccggacatgaactaagccctgtcggaaaaaca
aaaacactgcctgcccctggcgccaatgtaccgcaaatgacctttgcatttgcttcctgc
cagcaatatgagcacggatattatacggcctacaagcatatggcaaaggaaaagcttgat
cttgtcttccatctcggtgattacatatatgaatacggcccaaatgaatatgtatcaaaa
acaggcaatgtccgcacgcacaacagcgcggaaatcattacgctgcaagactatcggaac
cgtcacgctcaataccgttctgacgccaatcttaaagctgcacatgcggcattcccttgg
gttgtaacttgggatgaccatgaagttgaaaacaactatgccaataaaatacctgaaaaa
ggacagtcggttgaagcattcgtgctccgccgcgcggcagcataccaggcatactatgaa
catatgccgctccgcatttcctctttgccgaatggcccagatatgcagctgtaccggcac
tttacgtacggaaacctggcgtccttcaatgtgcttgatacccgccagtacagggacgac
caagccaataacgacggcaataagccgccttctgatgaatcgcgcaatccgaatcggacc
ctgcttggaaaagaacaggagcagtggctcttcaacaatttgggcagttcgacagcccac
tggaatgtgctggcgcagcagattttctttgccaagtggaatttcgggacaagcgcaagc
ccgatctacagcatggattcgtgggacggctacccggctcagcgcgaacgggtgatcaat
ttcattaaaagcaaaaatctgaataatgttgtcgtactgacaggtgatgtacacgcaagc
tgggcatcgaacttgcatgtcgatttcgagaagacaagttcaaaaatattcggagccgaa
tttgtcggaacctcgatcacttccggagggaacggcgccgataagcgagcggatacggac
caaattttaaaagaaaatccgcacatcaagttctttaacgactatcgcggatatgtccgc
tgtacagtgacgcctcaccagtggaaagccgattatcgggtgatgccgtttgtgaccgag
ccgggcgcagccatttccacgagggcttcattcgtttaccagaaagaccaaactgggttg
agaaaggtatcatccacaacaatccaaggcggggtgaagcaatccgatgaggtcgaagag
gatcgtttctttgcgcacaacaaagcccacgaaaaacaaatgattaagaagcgggcaaaa
atcacgaattaa

DBGET integrated database retrieval system