KEGG   Bacillus subtilis BSn5: BSn5_16585Help
Entry
BSn5_16585        CDS       T01417                                 

Definition
alkaline phosphatase A
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSn5_16585
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSn5_16585
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSn5_16585
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BSn5_16585
Exosome [BR:bsn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSn5_16585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3227956..3229332)
Genome map
AA seq 458 aa AA seqDB search
MSLFQNMKSKFLPIAAVSVLTAGIFAGAELQQTEKASAKKQDKAEIRNVIVMIGDGMGTP
YIRAYRSMKNNGDTPNNPKLTEFDRNLTGMMMTHPDDPDYNITDSAAAGTALATGVKTYN
NAIGVDKNGKKVKSVLEEAKQQGKSTGLVATSEINHATPAAYGAHNESRKNMDQIANSYM
DDKIKGKHKIDVLLGGGKSYFNRKDRNLTKEFKQAGYSYVTTKQALKKNKDQQVLGLFAD
GGLAKALDRDSKTPSLKDMTVSAIDRLNQNKKGFFLMVEGSQIDWAAHDNDTVGAMSEVK
DFEQAYKAAIEFAKKDKHTLVIATADHTTGGFTIGANGEKNWHAEPILSAKKTPEFMAKK
ISEGKPVKDVLARYANLKVTSEEIKSVEAAAQADKSKGASKAIIKIFNTRSNSGWTSTDH
TGEEVPVYAYGPGKEKFRGLINNTDQANIIFKILKTGK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgtttcaaaatatgaaatcaaaatttctgccaatcgccgctgtttctgtcctt
acagctggaatctttgccggagctgagctgcagcaaacagaaaaggccagcgccaaaaaa
caagacaaagctgagatcagaaatgtcattgtgatgataggcgacggcatggggacgcct
tacataagagcctaccgttccatgaaaaataacggtgacacaccgaataacccgaagtta
acagaatttgaccggaacctgacaggcatgatgatgacgcatccggatgaccctgactat
aatattacagattcagcagcagccggaacagcattagcgacaggcgttaagacatataac
aatgcaattggcgtcgataaaaacgggaaaaaagtgaaatcagtacttgaagaggccaaa
cagcaaggcaagtcaacagggcttgtcgccacgtctgaaattaaccacgccactccagcc
gcatatggcgcccacaatgaatcacggaaaaacatggaccaaatcgccaacagctatatg
gatgacaagataaaaggcaaacataaaatagacgtgctgctcggcggcggaaaatcttat
tttaaccgcaaggacagaaacttgacaaaggaattcaaacaagccggctacagctatgtg
acaactaaacaagcattgaaaaaaaataaagatcagcaggtgctcgggcttttcgcagat
ggagggcttgctaaagcgctcgaccgtgacagtaaaacaccgtctctcaaagacatgacg
gtttcagcaattgatcgcctgaaccaaaataaaaaaggatttttcttgatggtcgaaggg
agccagattgactgggcggcccatgacaatgatacagtaggagccatgagcgaggttaaa
gattttgaacaggcctataaagccgcgattgaatttgcgaaaaaagacaaacatacactt
gtgattgcaactgctgaccatacaaccggcggctttaccattggcgcaaacggggaaaag
aattggcacgcagaaccgattctctccgctaagaaaacacctgaattcatggccaaaaaa
atcagtgaaggcaagccggttaaagatgtgctcgcccgctatgccaatctgaaagtcaca
tctgaagaaatcaaaagcgttgaagcagctgcacaggctgacaaaagcaaaggggcctcc
aaagccatcatcaagatttttaatacccgctccaacagcggatggacgagtaccgatcat
accggcgaagaagtaccggtatacgcgtacggccccggaaaagaaaaattccgcggattg
attaacaatacggaccaggcaaacatcatatttaagattttaaaaactggaaaataa

DBGET integrated database retrieval system