KEGG   Bacillus subtilis BSn5: BSn5_16945Help
Entry
BSn5_16945        CDS       T01417                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSn5_16945
Enzymes [BR:bsn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BSn5_16945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3299085..3300497
Genome map
AA seq 470 aa AA seqDB search
MSDGKKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKIAP
FVSTGLFSLSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLVEE
IEKQLKLTKVYKGTKVTKLSRGGSGYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAI
SHLKNMHSTSVANVALGFPEGSVEMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGH
KQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggcaaaaaacatgtagtcatcatcggcggcggcattaccggtttagccgcc
gccttctatatggaaaaagaaatcaaagaaaagaatctgccgcttgaactgacgcttgtt
gaggcaagtccgagagtcggcggaaaaatccagactgtcaagaaggacggctatatcatc
gaaagagggccagactcatttctggaacgaaagaaaagcgccccgcagcttgttaaagac
ttaggtcttgagcatttgcttgtcaacaatgcgaccggacaatcctatgtgcttgtaaac
cgcaccctgcatccaatgccgaagggcgctgtaatggggataccgacaaaaattgcgccg
tttgtttctacgggtctgttttctttgtctgggaaggcgagagctgctatggatttcatc
ctgcctgcaagcaaaacaaaggatgatcagtcattgggagaattcttccgcagacgtgtc
ggagatgaagtggtcgagaacttaatcgagccgcttctatcagggatctatgcaggcgac
attgacaagctcagcctgatgtcgacattcccgcaattttaccagacagaacaaaagcat
agaagcctgattctcggcatgaaaaaaacaaggcctcaaggctcaggccagcagctgacg
gcaaagaagcaaggccagttccagactttgtcaaccggattgcaaacccttgttgaagag
atcgaaaagcagttaaagctgacgaaggtgtataaaggcacaaaagtgaccaagctcagc
cgtggcggctctggttactcgctcgaattggataacggcgtcacacttgatgctgattca
gtaattgtgactgctccgcataaagcggctgcgggaatgctttctgagcttcctgccatt
tctcatttgaaaaatatgcactccacatcggtggcaaatgtcgctttaggtttccctgaa
ggctccgtcgagatggagcatgagggcacgggttttgttatttcaagaaacagtgacttt
gcgatcactgcctgtacgtggacgaataaaaaatggccgcacgcagctccggaaggcaaa
acgctgcttcgggcatatgtcggaaaagctggagacgaatccattgtcgatctatcagat
aatgacattatcaacattgtgttagaagacttaaagaaagtcatgaacataaacggcgag
ccggaaatgacatgtgtcacccgatggcatgaaagcatgccgcagtaccatgtcggccat
aagcagcgtatcaaggagctgcgtgaagcacttgcatctgcgtatccgggtgtttatatg
acaggcgcttctttcgaaggtgtcggcattcccgactgcattgatcaaggaaaagctgcc
gtgtctgacgcgcttacctatttattcagctaa

DBGET integrated database retrieval system