KEGG   Bacillus subtilis BSn5: BSn5_17030Help
Entry
BSn5_17030        CDS       T01417                                 

Definition
serine alkaline protease (subtilisin E)
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bsn  Bacillus subtilis BSn5
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3315328..3316473)
Genome map
AA seq 381 aa AA seqDB search
MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAMSSAKKKDVIS
EKGGKVQKQFKYVNAAAATLDEKAVKELKKDPSVAYVEEDHIAHEYAQSVPYGISQIKAP
ALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAGTIAA
LNNSIGVLGVAPSASLYAVKVLDSTGSGQYSWIINGIEWAISNNMDVINMSLGGPSGSTA
LKTVVDKAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGS
ELDVMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTA
TYLGNSFYYGKGLINVQAAAQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgagaagcaaaaaattgtggatcagcttgttgtttgcgttaacgttaatctttacgatg
gcgttcagcaacatgtctgcgcaggctgccggaaaaagcagtacagaaaagaaatacatt
gtcggatttaaacagacaatgagtgccatgagttccgccaagaaaaaggatgttatttct
gaaaaaggcggaaaggttcaaaagcaatttaagtatgttaacgcggccgcagcaacattg
gatgaaaaagctgtaaaagaattgaaaaaagatccgagcgttgcatatgtggaagaagat
catattgcacatgaatatgcgcaatctgttccttatggcatttctcaaattaaagcgccg
gctcttcactctcaaggctacacaggctctaacgtaaaagtagctgttatcgacagcgga
attgactcttctcatcctgacttaaacgtcagaggcggagcaagcttcgtaccttctgaa
acaaacccataccaggacggcagttctcacggtacgcatgtagccggtacgattgccgct
cttaataactcaatcggtgttctgggcgtagcgccaagcgcatcattatatgcagtaaaa
gtgcttgattcaacaggaagcggccaatatagctggattattaacggcattgaatgggcc
atttccaacaatatggatgttattaacatgagccttggcggaccttctggttctacagcg
ctgaaaacagtcgttgataaagccgtttccagcggtatcgtcgttgctgccgctgccgga
aacgaaggttcgtccggaagctcaagcacagtcggctaccctgcaaaatatccttccact
attgcggtaggtgcggtaaacagcagcaaccaaagagcttcattctcaagcgcaggttct
gagcttgatgtgatggctcctggcgtatccatccaaagcacacttcctggaggcacttac
ggtgcttacaacggcacgtccatggcgactcctcacgttgccggagcagcagcgttaatt
ctttctaagcacccgacttggacaaacgcgcaagtccgtgatcgtttagaaagcactgca
acataccttggaaactctttctactatggaaaagggttaatcaacgtacaagcagctgca
caataa

DBGET integrated database retrieval system