KEGG   Bacillus subtilis BSn5: BSn5_17285Help
Entry
BSn5_17285        CDS       T01417                                 

Definition
asparagine synthetase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSn5_17285
Enzymes [BR:bsn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BSn5_17285
Peptidases [BR:bsn01002]
 Cysteine Peptidases
  Family C44
   BSn5_17285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3368136..3369980
Genome map
AA seq 614 aa AA seqDB search
MCGITGWVDFKKQLVQEKQTMDRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDIEGGR
QPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVDH
LNGIFAFAVWDEKRNLLFAARDRLGVKPFFYTKEGSSFLFGSEIKAILAHPDIKARVDRT
GLSEIFGLGPSRTPGTGIFKGIKEIRPAHALTFSKDGLNIWRYWNVESEKHTDSFDDTVA
NVRSLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKEGKAPLHTYSIDYEEND
KYFQASAFQPNDDGPWIEKMTETFGTTHHKCVISQKDLVDHLEEAVLVKDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHTADVESGFPWMRSTEERIKLLSDSWQKK
LNLKEYVNAKYEETLAETPLLDGETGVDKARRQLFYLNMLWFMTNLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWEMKMHDNREKGILRKALEGILPDDILYRKKSPYPKTHHPEY
TKGVSEWLKTIRSQKDSVLHTLLDRKQLDQLLETEGSSFKVPWFGQLMKGPQLIAHLAQI
HTWFEAYRIDIDER
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattacgggttgggtcgattttaaaaagcagctcgtccaggaaaaacaaacg
atggacagaatgacagacactctttccaaacgagggcctgatgattcaaacgtttggggg
gagcaccatgttttattcggacataaaagacttgcggttgttgatattgaaggcggacgc
cagccgatggcgtgtacctataaaggggatacgtacaccattatttacaatggcgagctt
tataacacggaagatttgcgcaaagaattgcgggcgcggggccatcaattcgagcgtacg
tcagataccgaggtgcttctgcacagctacatcgaatggcaggaagactgtgtcgaccat
ctcaatggcatattcgctttcgctgtgtgggatgaaaagcgtaatttgctgtttgccgcg
agagaccgtctcggcgtaaagccgtttttttacacgaaggaaggctcttcatttctcttc
gggtcggaaatcaaagcaatcctcgcgcaccctgatataaaagcgcgagtggacagaacg
ggactttctgaaattttcggtcttggaccgtccagaaccccgggcactggcatatttaaa
ggcataaaagaaatccgcccggctcacgcgctgacattttccaaagacggacttaatatt
tggcgttattggaatgttgaaagcgaaaaacatacggacagttttgatgacacggttgcc
aatgtcagatcgttatttcaggacgcggtgacgcggcagcttgtgtcggatgtgcctgtt
tgtacgttcctatcaggcggtctggactcaagcgcaattacagcgattgcggcgggccat
tttgaaaaggaaggaaaagcaccgcttcatacttattcgattgattacgaagagaacgat
aaatattttcaagcaagcgcatttcagccgaatgatgacggaccatggattgaaaaaatg
acagagactttcggcacgacgcaccacaaatgcgtcatcagccaaaaagatctcgttgat
catttggaggaagctgtactggtcaaagacttgccgggaatggcggatgtcgactcatcc
ctgctgtggttttgccgggaaatcaaaaaggactttgtcgtcagcctatcgggagagtgc
gcggatgagattttcggcgggtacccgtggttccatacggcagatgttgagtctggcttt
ccatggatgagatcaacggaggagcggatcaagctgctttctgactcatggcagaaaaaa
ttgaatctgaaagaatacgtaaatgccaaatatgaagaaaccttggcagaaacgccatta
ttagatggtgaaacgggtgtggataaagcaagaagacagctgttctatttaaatatgctt
tggtttatgacgaaccttttggatcggaaggatcgcatgagcatgggggcgagcctggaa
gtgcgggtgccgttcgccgatcaccggcttgtggaatatgtttggaatattccgtgggaa
atgaaaatgcatgataatcgggaaaaaggcattttacgcaaagcgcttgaaggtattttg
cctgatgacattctgtatcgcaaaaaaagcccgtatccgaaaacacaccatccggaatat
acaaaaggcgtcagcgaatggctgaaaacgatcagaagccaaaaggactccgtgctccat
accttactggacagaaaacaattagatcagcttttagaaacggaaggctcctccttcaag
gtgccgtggttcgggcagctcatgaaggggccccagctgatcgcccatcttgctcaaatt
catacatggtttgaagcgtatcgcattgatattgacgagaggtag

DBGET integrated database retrieval system