KEGG   Bacillus subtilis BSn5: BSn5_18585Help
Entry
BSn5_18585        CDS       T01417                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsn01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bsn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3592396..3593493
Genome map
AA seq 365 aa AA seqDB search
MKKQRIVVKIGSSSLTNSKGSIDEAKIREHVQAISVLKKAGHEMILITSGAVAAGFSSLG
YPSRPVTIKGKQAAAAVGQTLLMQQYMNQFKQYSLTPGQILLTRNDFSKRERYRNAYATI
MELLERGVIPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
NPEAKRFDYLPEITPELLGYAGSAGSKVGTGGMKSKLLAAQTALSLGVKVFIGTGSGAQK
LADILDGRGDGTYIGDKELSSVNNTRQWIQFHSPISGEIIIDAGAEEAMIHNGSSLLPAG
VVGVNGSFPKGAVVEVRGPGGVIGKGQTHYSSEEIMEAKGKRSDELDFEKTFEVIHRNDW
VNVKD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaagaatagtagtgaaaataggaagcagttcgctcacgaatagcaaagga
agcattgatgaggcaaaaatcagagagcatgttcaggcgatttccgtgttgaaaaaagcg
gggcatgaaatgattctgattacctcgggtgccgtagcggcggggttttccagcctcggt
tatccgtcccgtcccgttaccatcaaaggaaaacaggcggcggccgcggtcggacaaaca
ctgttaatgcagcaatatatgaatcaatttaaacaatactcattaactccgggacaaatc
cttttaacgagaaatgatttttcgaaaagagaacggtatcgaaacgcgtatgctacgata
atggaattattggaacgcggcgtcattccaattatcaacgagaacgattctacatctgtt
gaagaattgacattcggagataatgatatgctttctgcgttagtcagcggattgattcac
gcggaccagctcatgattctcaccgacattaacggactgtatgatgccaatccaaatgaa
aatcctgaggcgaaacgatttgattatttgccggagatcacgcctgaattgcttggatat
gcaggttcagctggatcaaaggtcggcaccggcggaatgaaatcaaagctgttggccgca
caaaccgcgctgtctctgggagtgaaagtattcattggaacaggcagcggggcgcaaaaa
cttgcggacattttggacggcaggggagacggcacttatatcggagacaaagaactatct
tcggttaacaacacgaggcagtggattcagttccactctccgatatctggagaaatcatt
attgatgcgggtgccgaagaggcgatgatccataatggaagcagccttttgcccgctggc
gttgtgggtgtgaacggaagctttccgaaaggggcggttgtggaagtcaggggaccgggc
ggcgtgatcggcaaaggccaaacccattactcctctgaggagattatggaggccaagggc
aaacgcagtgacgaacttgattttgagaaaacgtttgaggttattcataggaatgactgg
gtcaatgtaaaagactag

DBGET integrated database retrieval system