KEGG   Bacillus subtilis BSn5: BSn5_19290Help
Entry
BSn5_19290        CDS       T01417                                 

Definition
2-dehydropantoate 2-reductase (EC:1.1.1.169)
Orthology
K00077  
2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:bsn00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3724554..3725465
Genome map
AA seq 303 aa AA seqDB search
MKFLVVGAGGVGGYIGGRLSEKGNDVTFLVRQKRAEQLKKTGLVIHSEKGNVSFQPELIS
AGETGQFDVVIIASKAYSLGQVIEDVKPFIHQESVIIPFLNGYRHYEQLFAAFSKEQVLG
GLCFIESALDNKGEIHHTSTSHRFVFGEWNGERTERIRALEEAFSGVKAEVIISGHIEKD
IWKKYLFIAAQAGITTLFQRPLGPILATEAGRHTAQTLIGEICAVLRKEGVPADPDLEEE
SFRTMTSMSYHMKSSMLRDMENGQTTEGDHLHGFLLEKAKRLSLAAPVLETVYANLQMYE
AEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttggttgtcggagcaggtggagtaggcgggtatattggcggacggctttcg
gagaaaggaaatgatgtgacatttctcgtgcgccaaaaacgagctgagcagcttaaaaaa
accgggcttgtcatccatagtgaaaaagggaatgtatcatttcagcccgaactaatcagt
gccggagaaacagggcaatttgatgtcgttatcattgcttctaaagcatactcacttggt
caagtgatagaggatgtcaaaccatttatccatcaggaatctgtcattatccctttctta
aacgggtaccgccactatgagcagctatttgcggcattttcaaaagaacaggtgctgggc
ggcctgtgttttatagaaagtgctttagacaacaaaggagaaattcatcatacgagcaca
tcgcatcgttttgtatttggagaatggaacggcgagcgtacggagcggataagagcgctt
gaagaggcattttcaggtgtgaaggctgaagtcatcattagcgggcatatcgagaaggac
atttggaaaaagtatctctttattgcagcgcaagcggggatcacaacgttatttcaacga
ccgcttggcccaatcctcgccacagaagccggacgtcacacggcccaaactcttattggg
gaaatttgcgctgttttacgaaaagaaggtgttccggctgatccggatcttgaggaagag
agctttcgtacgatgaccagcatgtcttaccatatgaagtcctccatgcttcgagatatg
gaaaacggccaaacgactgaaggagaccacctgcatggatttttgcttgaaaaagcaaaa
cgtttatctctcgcagcaccagtattagaaaccgtttatgcgaatctgcaaatgtatgaa
gcagaaaaataa

DBGET integrated database retrieval system