KEGG   Bacillus subtilis BSn5: BSn5_19290Help
Entry
BSn5_19290        CDS       T01417                                 

Definition
2-dehydropantoate 2-reductase (EC:1.1.1.169)
Orthology
K00077  
2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSn5_19290
Enzymes [BR:bsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     BSn5_19290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3724554..3725465
Genome map
AA seq 303 aa AA seqDB search
MKFLVVGAGGVGGYIGGRLSEKGNDVTFLVRQKRAEQLKKTGLVIHSEKGNVSFQPELIS
AGETGQFDVVIIASKAYSLGQVIEDVKPFIHQESVIIPFLNGYRHYEQLFAAFSKEQVLG
GLCFIESALDNKGEIHHTSTSHRFVFGEWNGERTERIRALEEAFSGVKAEVIISGHIEKD
IWKKYLFIAAQAGITTLFQRPLGPILATEAGRHTAQTLIGEICAVLRKEGVPADPDLEEE
SFRTMTSMSYHMKSSMLRDMENGQTTEGDHLHGFLLEKAKRLSLAAPVLETVYANLQMYE
AEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttggttgtcggagcaggtggagtaggcgggtatattggcggacggctttcg
gagaaaggaaatgatgtgacatttctcgtgcgccaaaaacgagctgagcagcttaaaaaa
accgggcttgtcatccatagtgaaaaagggaatgtatcatttcagcccgaactaatcagt
gccggagaaacagggcaatttgatgtcgttatcattgcttctaaagcatactcacttggt
caagtgatagaggatgtcaaaccatttatccatcaggaatctgtcattatccctttctta
aacgggtaccgccactatgagcagctatttgcggcattttcaaaagaacaggtgctgggc
ggcctgtgttttatagaaagtgctttagacaacaaaggagaaattcatcatacgagcaca
tcgcatcgttttgtatttggagaatggaacggcgagcgtacggagcggataagagcgctt
gaagaggcattttcaggtgtgaaggctgaagtcatcattagcgggcatatcgagaaggac
atttggaaaaagtatctctttattgcagcgcaagcggggatcacaacgttatttcaacga
ccgcttggcccaatcctcgccacagaagccggacgtcacacggcccaaactcttattggg
gaaatttgcgctgttttacgaaaagaaggtgttccggctgatccggatcttgaggaagag
agctttcgtacgatgaccagcatgtcttaccatatgaagtcctccatgcttcgagatatg
gaaaacggccaaacgactgaaggagaccacctgcatggatttttgcttgaaaaagcaaaa
cgtttatctctcgcagcaccagtattagaaaccgtttatgcgaatctgcaaatgtatgaa
gcagaaaaataa

DBGET integrated database retrieval system